(data stored in ACNUC29543 zone)

EMBL: CP001044.PE430

CP001044.PE430       Location/Qualifiers
FT   CDS_pept        complement(504990..505775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3560"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bxe:Bxe_B0962 putative enoyl coenzyme A hydratase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3560"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72699"
FT                   /db_xref="GOA:B2JM09"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM09"
FT                   /protein_id="ACC72699.1"
FT                   /translation="MQYDTLTSAFDNGVATVTLNRPDVRNAFNEAMIAELTSAFRALDE
FT                   RDDVRAVVLAANGKAFCAGADLNWMKKMAGFSDDENRADALRLADMLASIYRCNKPVIA
FT                   RVNGDVYAGGMGLISACDIVVAVDTAKFCLSEARLGLIPATIAPYVIRALGEQASRRYF
FT                   MTAEAFDCATAHRLGFVSECVSADTLDETVGQLATTLCANGPHAVKACKQLVHDIAGRE
FT                   ISAALIEDTAVRIAKTRAGEEGREGVASFLEKRSPAWRA"
     atgcaatacg acacgctgac cagcgcattc gataacggcg tcgccactgt gacgctgaac        60
     cggcctgacg tgcgcaatgc gttcaacgaa gcgatgatcg cggaacttac gtccgcgttc       120
     cgcgcgctgg acgagcgcga cgacgtgcgc gccgtcgtgc tcgcggcgaa cggcaaggcg       180
     ttctgcgcgg gcgcggatct gaactggatg aagaagatgg ccgggttctc ggacgacgag       240
     aaccgcgccg acgcgctgcg tctcgccgac atgctcgcgt cgatctatcg ctgcaacaag       300
     ccggtgattg cacgcgtgaa cggcgatgta tacgcgggcg gcatgggcct gatctcggcg       360
     tgcgacatcg tggttgccgt cgataccgcg aagttctgtc tgtccgaagc gcgcctcggc       420
     ctgattcccg cgacgattgc gccgtacgtg atccgtgcgc taggcgagca ggcgtcgcgc       480
     cgctatttca tgacggcgga agcgttcgat tgcgcgactg cgcatcggct gggtttcgtc       540
     agcgagtgcg tgagcgccga cacgctcgac gaaacggtcg ggcaacttgc gaccacgcta       600
     tgcgcaaacg gtccgcacgc ggtgaaagcc tgcaagcagc tggtgcacga tatcgcgggc       660
     cgcgaaatca gcgcggcact gatcgaagac acggcggtac gcatcgcgaa gacgcgagca       720
     ggcgaggaag gacgcgaagg cgtcgcgtcg ttcctcgaaa agcgttcgcc tgcgtggcgg       780
     gcgtga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page