(data stored in ACNUC29543 zone)

EMBL: CP001044.PE435

CP001044.PE435       Location/Qualifiers
FT   CDS_pept        complement(510649..511233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3565"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72704"
FT                   /db_xref="InterPro:IPR025693"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM14"
FT                   /protein_id="ACC72704.1"
FT                   /translation="MNETQVARKVAVPTLVVGVLLALGGCAVAPPSGPSVVALPRKGEP
FT                   LEQFQQEDYACRDYAYHSTNANGAAQAATNNAAGSAAVGTLGGAAVGALFGAAAGNPGA
FT                   GAAIGAGSGLLIGGATGANGASYSAYGLQARYDAAYAQCMMSKGNSIAQPQAPVYATPP
FT                   AYYAPAPVYYGPPRPYYYGPPGVVYAPYPYY"
     atgaacgaga ctcaggtcgc tagaaaagtc gctgtgccga cgcttgtcgt cggggtgttg        60
     cttgcattgg gcggttgcgc cgtcgcgccg cccagcgggc cgagcgtcgt ggcgctgccg       120
     cgcaagggcg agccgctcga acagttccag caggaagact acgcgtgccg cgactatgcg       180
     taccacagca cgaacgcgaa cggcgcggcg caggcggcga cgaacaatgc ggcgggcagc       240
     gcggccgtcg gtacgctggg cggcgcagcc gtcggcgcgc tgttcggtgc ggcggcgggc       300
     aatccgggtg cgggcgcggc aatcggcgcg ggcagcggcc tgctgatcgg cggcgccacg       360
     ggcgcgaacg gtgcgtcgta ttcggcgtat ggcttgcagg cccgctacga tgcggcatac       420
     gcgcagtgca tgatgtcgaa gggcaacagc attgcgcagc ctcaggcgcc cgtctatgcg       480
     acgccgcctg catactatgc gcccgctcct gtgtattacg ggccgccgcg tccgtactat       540
     tacggcccgc ccggtgtggt ctacgcgcca tatccgtatt actga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page