(data stored in ACNUC29543 zone)

EMBL: CP001044.PE436

CP001044.PE436       Location/Qualifiers
FT   CDS_pept        511443..511976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3566"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: bxe:Bxe_B0948
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3566"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72705"
FT                   /db_xref="GOA:B2JM15"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM15"
FT                   /protein_id="ACC72705.1"
FT                   /translation="MTRRTENLLGVLALLVTDELDAQPSIPALSGITARAMLNAIGQYP
FT                   DSSIELLRDAVDLSHPAAVRATAGLVDAGLVEKKAGSDKRSVALVLTASGRREAKRMRS
FT                   ARGRMLKRIVARLDENEREVFERLLIKILWNETRDASHAMQLCRFCDDKPCLKAGCPVE
FT                   CRDHGLSMPGGSAS"
     atgacccggc gcacggaaaa tctgctcggc gtgctcgccc ttctggtaac ggacgaactc        60
     gacgcacaac cttccattcc cgcactgtcc ggcataacgg cacgggcgat gctcaacgca       120
     atcggccaat acccggattc gtctattgaa ctgctgcgcg atgccgtcga cctatcgcat       180
     cccgctgccg tgcgcgccac cgcaggtctc gtcgatgcgg ggctggtcga aaagaaagca       240
     ggcagcgaca agcgctccgt cgcgctggtg ttgacggcaa gcggacgccg tgaagcgaag       300
     cgcatgcgaa gcgcgcgcgg gcgcatgctc aaacggatcg tcgcgcggct cgatgaaaac       360
     gaacgcgagg tattcgagcg tttgctgatc aagattctct ggaacgaaac ccgcgacgcg       420
     tcgcacgcga tgcaactgtg ccgcttctgc gacgacaagc cgtgcctgaa agcaggctgt       480
     cctgtcgaat gccgcgacca cgggctgtcg atgccgggcg gaagcgcctc ctga             534
//

If you have problems or comments...

PBIL Back to PBIL home page