(data stored in ACNUC29543 zone)

EMBL: CP001044.PE446

CP001044.PE446       Location/Qualifiers
FT   CDS_pept        complement(520626..521162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3576"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B4332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3576"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72715"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM25"
FT                   /protein_id="ACC72715.1"
FT                   /translation="MRTLLRAIVTVACVAAALGVLFVPLPGAFNLSTSIVTVMPIARSS
FT                   TAVFDYVTTLAHWPAWHPSSLSVTGAIDHPLDLGERTTEEFRVAGRRGHVVWTVVERRR
FT                   PEKWTIDGMIEGRPAGTVSYALTSDADGTQFERTFTYRSPTLWFALLNAVLLRAKIQAE
FT                   SDEAVERLKRVLEQP"
     atgagaacgc tactgcgagc gatcgtgaca gtggcatgcg tggcggccgc cctcggtgtt        60
     ctattcgttc cactgccggg cgcgttcaat ctctcgacga gcattgttac cgtcatgccg       120
     atcgcgcgct cgtccacggc cgttttcgac tatgtgacga cgcttgcgca ctggcccgcg       180
     tggcatccgt cgtcgttgtc ggtgacgggc gcgatcgatc acccgcttga tctgggagag       240
     cggaccacgg aagaatttcg tgtcgcgggg cggcgcggac atgtcgtatg gacggtcgtc       300
     gaacgccgac gccccgaaaa atggacgata gacggcatga tcgaaggccg tccagcaggc       360
     accgtcagct acgcgctgac ctccgatgcc gacggcacgc agttcgagcg cactttcacg       420
     tatcgctcgc cgacgctctg gttcgcgctg ctcaacgccg tgctgctgcg cgcgaagatc       480
     caggccgagt ccgatgaagc cgtcgaacgg ctcaagcgcg tgctcgaaca gccctag          537
//

If you have problems or comments...

PBIL Back to PBIL home page