(data stored in ACNUC29543 zone)

EMBL: CP001044.PE45

CP001044.PE45        Location/Qualifiers
FT   CDS_pept        41947..43665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3146"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /note="TIGRFAM: precorrin-3B C17-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; cobalamin (vitamin B12) biosynthesis
FT                   CbiG protein; KEGG: bur:Bcep18194_A4821 precorrin-3B
FT                   C17-methyltransferase region"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3146"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72314"
FT                   /db_xref="GOA:B2JRI7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRI7"
FT                   /protein_id="ACC72314.1"
FT                   /translation="MTVPPAIVTLGVGALDTARRVQALYDGAQVHGLQGRVNEADIAYT
FT                   ELGAHLRELYASGTPIVALCAAGIVIRCVAPLLSNKGGEPPVLAVAEDGSAVVPLLGGL
FT                   SGVNAMAREIAGALDVPPAITTSGELRFGACVLNPPEGYALASLDHGKRFVSDLLAGEA
FT                   TRIEGDAPWLDDVQLPRVDNARRTIRVTPLAWSGATDELVIHPRSVVVAVHASATGDNL
FT                   HERVLEAARVQGLAAPSLAVLLAPASQIGDPVLRDVADALHVALRFAADSEAASNAADM
FT                   LRQTLRVPHTAFVTDAPIAFAAAHAPLDPATVGRARGKLSVVGLGPGDASLMVPAARAA
FT                   LTQATDILGYDTYVKMAGPFRAEQRVHGTDNREEMQRARHAFELASAGHHVAMVSSGDP
FT                   GVFAMAAAVLEALDEAHADAHRAAWSAVELEIVPGVSAAFATAAQAGAPLGHDFCVLSL
FT                   SDNLKPWTVIETRLRHAAEADLVMAFYNPISRARPWQLDRALDIVRDLRAPSTVVVLGR
FT                   DIGRPGATLKTTTLAELQSSDVDMRTMVIIGSTTTRAFNAAEPRRTWVYTPRWYA"
     atgaccgtgc cgcccgcgat cgtgacactg ggcgtcggcg cgctcgacac cgcacggcgt        60
     gtgcaggcgc tctacgacgg cgcacaggtg cacggcctgc aagggcgtgt gaacgaagcc       120
     gatatcgcgt acacggaact cggcgcgcat ctgcgcgaac tgtatgcgag cggcacgccc       180
     atcgtcgcgc tgtgcgcggc cggcatcgtc attcgctgcg tggcgccgtt gttgtccaac       240
     aaggggggcg agccgcccgt gctcgccgtc gcggaagacg gcagcgccgt cgtgccgctg       300
     ctcggcggtc tgtccggtgt gaacgcgatg gcgcgcgaga tcgccggggc gctcgatgtg       360
     ccgcccgcga tcacgacgag cggcgaactg cgcttcggcg catgcgtgtt gaatccgccc       420
     gaaggctatg cgctcgccag tctcgatcac ggcaagcgct tcgtgtccga tctgctcgcg       480
     ggcgaggcga cgcgcatcga gggcgacgcg ccgtggctcg acgacgtgca actgccgcgc       540
     gtcgacaacg cccgccggac gatccgcgtg acgccgctcg cctggagcgg tgccaccgac       600
     gaactggtga tccatccgcg cagcgtggtc gtcgcagtcc atgcaagcgc gacaggcgac       660
     aacctgcacg aacgcgtgct cgaagcagcg cgagtgcaag gactggcggc gccgtcgctg       720
     gccgtgctgc ttgccccggc ttcgcagatc ggcgatcccg tgcttcgcga cgtcgcggac       780
     gcgctgcacg tcgcattgcg cttcgcagcg gacagcgaag cggcaagcaa cgctgccgac       840
     atgctccggc agactttgcg cgtaccgcac acggcattcg ttactgacgc gcccatcgca       900
     ttcgccgccg cccatgcgcc gctggatccc gctaccgtgg gccgcgcgcg cggcaagctg       960
     agcgtggtcg gactgggtcc cggcgatgcg tcgctgatgg tgcccgccgc ccgcgcggca      1020
     ctgacgcagg ccactgacat cctcggctac gacacttacg tgaagatggc gggtccgttc      1080
     cgcgcggagc agcgcgtgca cggcaccgac aatcgcgagg agatgcagcg cgcgcgccat      1140
     gctttcgaac tggcgagtgc gggacatcat gtcgcgatgg tttcatcggg cgatccaggc      1200
     gtgttcgcga tggcagccgc cgtgctcgaa gcgctcgacg aagcccatgc cgacgcgcac      1260
     cgcgcggcat ggtccgccgt cgaactcgag atcgtgcccg gggtgtcggc tgcatttgcg      1320
     acggccgcgc aggcaggcgc gccgctcggt cacgatttct gcgtgctgtc gctgtccgac      1380
     aatctgaaac cgtggacggt catcgaaacg cggctgcggc acgcggccga agccgacctg      1440
     gtgatggcgt tctacaaccc catctctcgc gcgcggccct ggcaactgga cagggccctc      1500
     gatatcgtgc gcgatttgcg cgcgccgtcc accgtcgtgg tgctcggccg cgatattggg      1560
     cgtcccggcg cgacgttgaa gaccacgacc ctcgccgaac tgcaatcgtc cgatgtcgac      1620
     atgcgcacga tggtgataat aggttcgacc acgacgcgcg cattcaatgc cgcggagccg      1680
     cgacgcacat gggtctatac gccccgctgg tacgcgtga                             1719
//

If you have problems or comments...

PBIL Back to PBIL home page