(data stored in ACNUC29543 zone)

EMBL: CP001044.PE454

CP001044.PE454       Location/Qualifiers
FT   CDS_pept        528035..528295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3584"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3584"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72723"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM33"
FT                   /protein_id="ACC72723.1"
FT                   /translation="MTIEFTSRRHVVAASRVAFEATVEGKEVWCSVSIDALNDHFGNTG
FT                   TSSHDLIAAFEGNRRKIEDAARRVLQRNGGQSVELETRDFH"
     atgaccatcg aattcaccag ccgccggcac gtcgtggccg catcgcgagt cgcattcgaa        60
     gcgaccgtcg aaggaaaaga ggtatggtgc agcgtatcaa tcgacgccct gaacgaccac       120
     tttggcaaca cgggcacgtc gtcgcacgat ctgatcgcgg cgttcgaagg taatcgcagg       180
     aaaatcgaag acgcagcccg gcgcgtgctg caacgaaatg ggggacagtc ggtcgagctg       240
     gagactcgcg actttcattg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page