(data stored in ACNUC29543 zone)

EMBL: CP001044.PE456

CP001044.PE456       Location/Qualifiers
FT   CDS_pept        complement(529570..529917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3586"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72725"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM35"
FT                   /protein_id="ACC72725.1"
FT                   /translation="MRDGPVCLEGTSQRFCCRIALNKEPLTRAQVREELVQLHDAGYSP
FT                   LDDRNSYPTDIPECRGPHRGSTSRVVAAKRIWQRVEWRVAGGCAQGCGRHCVRASLTAC
FT                   WLAHERVLRVP"
     gtgcgcgacg gccccgtttg ccttgaaggg acttcgcagc gtttctgttg ccgcattgca        60
     ctgaacaaag agcccctcac gcgcgcgcaa gttcgcgaag aactcgtgca attgcatgac       120
     gccggttata gcccgctgga cgatcgcaat agctacccga cggacatccc agaatgccga       180
     ggcccgcatc gcggctcaac aagccgcgtc gtcgcagcaa agcggatatg gcagcgcgtc       240
     gaatggcgcg tcgcaggcgg gtgtgcgcag ggatgcggac ggcattgcgt tcgcgcatca       300
     ttgactgcgt gctggttggc gcacgagcgt gtattgcgag tgccctga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page