(data stored in ACNUC29543 zone)

EMBL: CP001044.PE458

CP001044.PE458       Location/Qualifiers
FT   CDS_pept        complement(530430..530969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3588"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B3009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3588"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72727"
FT                   /db_xref="GOA:B2JM37"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM37"
FT                   /protein_id="ACC72727.1"
FT                   /translation="MISQQAKESIERIFLHSARTRLPIDSADACAIAPLDAQHANEALA
FT                   AHIVVLTISSIAFRFLLVLHFDDDKTTRDYYLRESEDRSLAEALMEVGNLCCGAINQKM
FT                   VEFFPDLGMSTPYQLSGACVPYLTELKPDYLAAFRVTIGANVQLGATLCVCASSHVDFV
FT                   ASIDEAEESTGELELF"
     gtgatcagtc agcaagcgaa agaaagcatc gagcggatct ttttgcattc cgcgcgtacg        60
     cgtttgccga tcgactccgc cgacgcatgc gcgatcgcgc cgctcgacgc acagcatgcg       120
     aacgaagcac tggcggccca tattgtcgtg ttgacgattt cgtcgatcgc cttccgcttt       180
     ttgctcgtcc tgcatttcga cgacgacaag acaacccgcg actattacct gcgcgagtcg       240
     gaagaccggt cattggcgga agcactgatg gaagtcggca atctgtgttg tggcgcgatc       300
     aatcagaaga tggtcgagtt ctttccggat ctcggcatgt cgacgcctta tcagttgagc       360
     ggtgcgtgcg tgccgtatct gacggagttg aagccggact atctcgcggc ttttcgcgtg       420
     accatcggcg caaacgtaca actgggtgcg acgctttgcg tatgtgctag ctcacacgtc       480
     gatttcgtcg cctctatcga tgaagcggaa gaaagcacgg gtgagctcga acttttctaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page