(data stored in ACNUC29543 zone)

EMBL: CP001044.PE460

CP001044.PE460       Location/Qualifiers
FT   CDS_pept        complement(531723..534113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3590"
FT                   /product="putative CheA signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   bxe:Bxe_B3011 CheA signal transduction histidine kinases
FT                   (STHK)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3590"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72729"
FT                   /db_xref="GOA:B2JM39"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM39"
FT                   /protein_id="ACC72729.1"
FT                   /translation="MTIRHRITLLVVLMLVALSAIGGYAVYQTRGSAADVKQVTQGVVP
FT                   SALASADLVSQVKDVQLATMTLVYAPDANLVEQAQKELAAKQKSLGAALDMQAKAAASH
FT                   AQEGLVTQARDSLANYFSAINDTAKMKAEGKNDLAQAYLFANVAQYRDELEGIVETLRI
FT                   EKNRQKDEAIDALNTGLATTTTAIGSASGAAILVLIAIGLLLYRQITRPLSRMQEMMSE
FT                   IASSQDFTRRVPVGRMDEIGHSIVAFNGMIEKIQQSSAQLKQKTADIQAMLQNMQQGIL
FT                   TVVDGAVIHSEYSAYLEAIFETKDIANRPLMDLVFAGSDLGSDTVSQVEAAVLACLGED
FT                   SINFEFNQHLLVNELTRTMPDGREKTLDVSWSAITDESDTVMRLMLCVRDVTELRRLAA
FT                   EAGEQKRRLEMIGEILAVNEEKFHHFVDSATGFINENERIIRQHTHADGSAVAELFRNM
FT                   HTIKGNARTYSLQHLTSIVHDTEQRYDALRRPESAHEWDQEVLMAELARVKEALQHYAT
FT                   INEVSLGRRKAGRVHSAERYLVVDRDHIQESLRLLDAANPADMRDLLRARDAVRRTLRL
FT                   LGTEKLEDALAGVLQSLPSLAAELGKVAPQVRIDDNGYRVRSQAGATLKNVFMHLLRNA
FT                   VDHGIESIEQRIAFGKPQAGVIEIEVGVAEGALQITLSDDGRGLALSRIRGIAADRGWL
FT                   QPDSQMSDEAIAEFIFRPGFSTAQNVTEVSGRGVGMDAVRDFIRREGGRIELRFTDDRA
FT                   GADFRQFQTIVYLPENCAVDSVGTSMQDAEKTVSSIQANAHSE"
     atgaccatcc gtcaccgcat cactctactg gtggtgttga tgctggtcgc cttgtcggcg        60
     atcggcggat acgctgtcta tcagactcgc ggcagcgccg ccgacgtcaa gcaggtcacg       120
     cagggcgtcg tgccgagcgc actcgcttcc gccgatctcg tttcgcaggt caaggacgtg       180
     cagctcgcga caatgactct cgtctacgca cccgacgcaa acttggtcga gcaggcgcaa       240
     aaagaactcg cggcgaaaca gaagtcgctg ggcgcagcac tggacatgca agccaaagcg       300
     gccgcgagcc acgcgcagga agggctggtc acgcaggcgc gcgacagcct cgcgaattac       360
     ttctcggcga tcaacgacac cgcgaagatg aaggccgaag gcaagaacga tctcgcgcaa       420
     gcgtatctgt tcgcgaacgt cgcgcaatat cgcgacgaac tggaaggtat cgtcgaaacg       480
     ctgcgcattg aaaagaaccg ccagaaagac gaagccatcg atgcgctcaa caccggcctc       540
     gcgacaacga ccacggcgat cggcagcgca tcgggcgcgg cgattctggt gctgatcgca       600
     atcggcttgc tgttgtatcg ccagatcacg cggccgctgt cgcggatgca ggaaatgatg       660
     agcgagatcg catcgagcca ggatttcacg cgccgcgtgc ccgtggggcg catggatgaa       720
     atcggccatt cgatcgtcgc gttcaacggc atgatcgaga agatccagca aagctccgcg       780
     cagctcaagc agaagacggc ggacattcag gcgatgttgc aaaacatgca gcaaggcatt       840
     ctgacggtgg tcgacggcgc ggtgattcac tcggagtact cggcctatct cgaagcgatc       900
     ttcgaaacga aagacattgc gaaccgcccg ctaatggatc tcgtgtttgc gggcagcgac       960
     ctcggttcag atacggtgtc tcaagtcgaa gcggcggtgc tcgcgtgtct cggcgaggac      1020
     agtatcaact tcgaattcaa ccagcatctg ctcgtcaacg aactgacgcg cacgatgccc      1080
     gacggccgcg agaagacgct cgatgtgagc tggtccgcga tcaccgacga aagcgacacg      1140
     gtgatgcgcc tgatgctgtg cgtgcgcgac gtaacggagc tgcgccggct cgccgccgaa      1200
     gcaggggagc agaagcgccg gctcgaaatg atcggcgaga ttctcgccgt caacgaagag      1260
     aagttccatc acttcgtcga cagcgcgacg ggcttcatca acgagaacga acgcatcatt      1320
     cgccagcaca cgcatgccga cggttccgcc gttgccgaac tgttccgcaa catgcacacg      1380
     atcaaaggca atgcgcgaac ctatagtctg cagcatctga ccagcatcgt tcatgatacg      1440
     gagcagcgtt acgacgcgtt gcgccgaccc gagtcggcgc acgagtggga ccaggaagtg      1500
     ttgatggccg aactcgctcg cgtgaaagaa gcgttgcaac actacgcgac gatcaacgaa      1560
     gtaagcctcg gccgtcgaaa ggcggggcgc gtccacagcg cggaacgcta tctggtggtg      1620
     gatcgggatc acattcagga aagcctgcgt ctgctcgatg cagcaaatcc cgccgacatg      1680
     cgcgatctgc tgagggcgcg cgacgccgta cgcagaacct tgcgtctgct cggcacggag      1740
     aagttggaag atgcgctggc gggcgtgctt caatcgctgc cgtctctggc cgccgaactc      1800
     ggcaaggttg cgccccaagt gcgtatcgac gacaacggct accgcgttcg ctcgcaggcg      1860
     ggcgccacgc tcaagaacgt gttcatgcat ctcctgcgca atgcggtcga tcacggcatc      1920
     gagtccatcg aacagcgcat cgcattcggc aagccgcaag caggcgtgat cgagattgaa      1980
     gtgggcgtcg cggaaggcgc gttgcagatc acgctgagcg acgacggacg cggcctcgcg      2040
     ctgtcacgca ttcgcggcat cgctgccgat cgcggctggc tgcagcccga ttcgcaaatg      2100
     agcgacgaag ccatcgcgga gttcatcttc cgtcccggct tttcgacagc gcagaacgtg      2160
     acggaagtct cggggcgcgg cgtcggcatg gatgctgtgc gcgacttcat ccggcgcgaa      2220
     ggcggccgca tcgaattgcg cttcaccgac gatcgtgcgg gagcggactt ccgccagttc      2280
     cagacgatcg tctatctgcc tgagaactgt gccgtcgata gcgtcggcac atcgatgcag      2340
     gacgccgaga agacagtgag ttcgattcag gcgaacgctc attccgaata g               2391
//

If you have problems or comments...

PBIL Back to PBIL home page