(data stored in ACNUC29543 zone)

EMBL: CP001044.PE463

CP001044.PE463       Location/Qualifiers
FT   CDS_pept        536894..537883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3593"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bxe:Bxe_B0893 ABC sugar transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3593"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72732"
FT                   /db_xref="GOA:B2JM42"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM42"
FT                   /protein_id="ACC72732.1"
FT                   /translation="MSTPTVPAHSHRRLADHLPTLAEAGPLIALVIACIFFISQSNRFL
FT                   SFQNLSLILQQTMVVAVIAIGQTLIVLTGGIDLSCGMVMALGSIVMTKFAVVMGVPPVI
FT                   AIVCGVGASTLFGLLNGVLITRIKLPAFIVTLGTLNIAFAVTQIYSNAESVSNLPDAIM
FT                   FFGNTFNLGPATVTYGTVLTLLMYLATWFVLRDTVPGRHLYALGNNPEAARLMGLSAQR
FT                   ILITVYTLSGAIYGIAALLAVSRTGVGDPQAGQTENLDSITAVVLGGTSLFGGRGSIAG
FT                   TLLGALIVGVFRNGLTLMGVSSVYQVLITGILVILAVAADKLSRRGAR"
     atgtcgactc ccaccgttcc cgctcacagc caccgccggt tggcggatca tctgccgacg        60
     cttgcagaag cgggcccgtt gatcgcactc gtgatcgcgt gcatcttctt catctcgcag       120
     agcaaccgtt ttctatcgtt ccagaacctg tcgctgatcc ttcagcagac catggtggtc       180
     gccgtcatag cgatcggcca gacactcatc gtactgacgg gcggcatcga tctgtcgtgc       240
     gggatggtga tggcgctcgg ctcgatcgtg atgacaaagt tcgccgtcgt gatgggcgtc       300
     ccgccggtga tcgcgatcgt gtgcggcgtc ggcgcgagca cgctgtttgg tctgctgaac       360
     ggcgtgctca tcacgcgcat caagctgccc gcgttcatcg tcacactggg cacgctgaat       420
     attgcattcg ccgtcacgca gatctattcg aacgctgaga gcgtatcgaa tctgcccgac       480
     gcgatcatgt tcttcggcaa cacgttcaat ctcggacccg caaccgtcac gtacggcacc       540
     gtgctcacgc tgctgatgta cctcgcgacg tggttcgtgc tgcgcgacac cgtgccaggc       600
     cgccatctct acgcactcgg caacaacccc gaagccgcgc gcctgatggg cctttccgcg       660
     cagcgcatcc tgatcaccgt ctacacgctg tcgggtgcga tctacggcat cgccgcactg       720
     ctggccgtgt cgcgcacggg ggtcggcgat ccgcaagcgg gccagacgga aaacctcgac       780
     agcatcacgg ctgtcgtgct gggcggcacg agcctgttcg gcggacgcgg ctcgattgca       840
     ggcacgctgc tgggcgcatt gatcgtcggc gtgttccgca atggcttgac gctgatgggc       900
     gtgtcgtcgg tgtaccaggt gctcatcacc ggcattctcg tgattctcgc agtcgccgcc       960
     gacaaactgt cgcgccgtgg cgcacgttga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page