(data stored in ACNUC29543 zone)

EMBL: CP001044.PE464

CP001044.PE464       Location/Qualifiers
FT   CDS_pept        537907..538707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3594"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B0892 ABC sugar transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3594"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72733"
FT                   /db_xref="GOA:B2JM43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM43"
FT                   /protein_id="ACC72733.1"
FT                   /translation="MSTSPSSANGKTAVLQARGLIKRYGHVTALDGCDFEVMPGEIMAV
FT                   IGDNGAGKSSLIKALSGALVPDEGELLLDGKPVKFRSPIDARQQGIETVYQDLAVAPAM
FT                   SIAENLFLARELVKPGWRGKIFKMIDKRRMLEEATNAMKDLQIGIRSMRQAVETLSGGQ
FT                   RQGVAVARSAAFARHVVILDEPTAALGVKEGNMVLELIRRVRDRGLPVILISHNMPHVF
FT                   EIADRIHIQRLGRRAALVNKSDIHMSDAVAIMTGAKQADVRAIA"
     atgtcgacat ccccctcttc cgccaacggc aagaccgctg ttctgcaggc acgtggactg        60
     atcaagcgct acggccacgt caccgcactc gatggctgcg actttgaagt gatgccgggc       120
     gaaatcatgg ccgtgatcgg cgacaacggc gcgggcaagt cgtcgctgat caaggcgctg       180
     tccggcgcgc tggtccccga cgaaggcgaa ctgctgctcg acggcaagcc cgtcaagttc       240
     cgcagcccga tcgacgcgcg ccagcaaggc atcgagaccg tctatcagga tctcgccgtc       300
     gcgcccgcga tgagcatcgc ggagaacctg ttcctcgcgc gcgaactcgt caagcccggc       360
     tggcggggca agatcttcaa gatgatcgac aagcgccgca tgctggaaga agcgaccaac       420
     gcaatgaagg acttgcagat cggcatccgt tcgatgcgcc aggccgtcga aaccctgtcg       480
     ggcggtcagc gtcagggcgt cgcggtggcg cgcagcgcgg cgttcgcgcg gcacgtcgtg       540
     attctcgacg aaccgacggc ggccctcggc gtgaaggaag gcaacatggt gctcgaactg       600
     atccggcgcg tgcgcgaccg cggcctgccc gtcattctga tcagccacaa catgccgcac       660
     gtgttcgaga tcgctgaccg cattcacatt cagcggctcg gccggcgggc ggcgctcgtg       720
     aacaagagcg acatccacat gtcggacgcc gttgcgatca tgacgggcgc gaaacaggcc       780
     gatgtacgcg caatcgcgtg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page