(data stored in ACNUC29543 zone)

EMBL: CP001044.PE466

CP001044.PE466       Location/Qualifiers
FT   CDS_pept        complement(540048..543107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3596"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51; KEGG:
FT                   bxe:Bxe_B0890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3596"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72735"
FT                   /db_xref="GOA:B2JM45"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM45"
FT                   /protein_id="ACC72735.1"
FT                   /translation="MNRPLRFPLRAIGTTSVWKWFKWLFFAAFLVAVAFGVRFLQIEMD
FT                   TSRLQARYLSELTRDVGFTVSEGPSDNIRFPTDGPYDIRLGYALLPAFERRLKERGFAV
FT                   ASQARDSERMASLADDGLFIPYDEKDQAGLTLYDATGTRLFGAQYPARVYDDFEAVPPL
FT                   VVSALLFIEDRHLLDSDQPNRNPAIDWGRFSRALMDQGLRVFNHTQPQPGGSTLATQIE
FT                   KFRHSPGGRTATPKEKLRQIASASVRAYLDGPRTMPAREQIVVRYLNSVPLAAQPGIGE
FT                   VNGIGDGLAAWYGRDFAEVNRVLKAPPTPENLPEQGLAFRQVLSLMIAQRGPSHFLLRK
FT                   NDELNALTESYLRIFATNGVITPQLRDAALAQQLVLTRAKVATPEGSFIERKAVTSLRT
FT                   HLLSSLGVSNLYDLDRLDVRVTSTMNNQVQQAISDRLAAATTKDGAQAAGLYGFNMLQP
FT                   KDDPSKIAFSFTLFEKRDGVNLLRVQTDSVNRPFDINSGARLNLGSTAKLRTIITYLQI
FT                   MSELHARYGQMSVDELRAVKPEREDALTRWAVDYFMHTNDRSLPAMLDASVERKYSANA
FT                   GETFFTGGGAQTFTNFEADENSRILTVHQAFQHSVNLVFVRIMRDIVHYETIKTSGPSS
FT                   QWLSDPDTRKMYLTRFADQESRVYMNRFYTKYHGKTQDEMLAVLLRGVRKSPPKVATVL
FT                   RSVRPDAPQAWFNSQMRAALKNTPKANPPDDALAELYAKYAIDKFNLNDRAYISSVHPL
FT                   ELWLVNYLRERPEASANDVMEASREVRADAYKWLFKTRYHATQDRRIRRMVEQHAYDAI
FT                   GKSWQALGYPFAHLTPSYAAAIGASGDRPAALAQLIGVIANKGNQAPTQSLSELEFAKG
FT                   TPYETRFVRATPQPNEAISPEIARVAQAMMRDVVAGGTAKRLAGGMTFPNGTTLEVYGK
FT                   TGTGDQRLNIYAKGRRLIESRKVNRTATFVFAIGDRFFGTLTAVVHEPYAKRYDFTSAL
FT                   AVQLLKSMAAELQPLLDPSTDAGGSTTASR"
     atgaatcggc cactacggtt tccgttacgc gcaatcggca ccacttctgt ctggaagtgg        60
     ttcaagtggc tctttttcgc cgcgtttctc gtcgctgttg ccttcggcgt gcgctttctc       120
     cagatcgaga tggacacgtc gcgattgcag gcgcgctacc tgtccgaact cacgcgcgac       180
     gtcggcttca ccgtatcgga agggcccagc gacaacatcc gttttcctac cgacggacct       240
     tacgacatcc gcctcggcta cgcgctgcta cccgctttcg agcgccgtct gaaagagcgc       300
     ggctttgccg tggcctcgca ggcgcgcgat tcggaacgca tggcgtcact cgccgacgac       360
     ggccttttca ttccttacga tgaaaaggat caggctggcc tgacgctcta tgacgcgacg       420
     ggcacgcgcc tgttcggcgc gcaatatccc gcgcgcgtgt atgacgattt cgaggcggtg       480
     ccgcccctcg tcgtgtcggc gctactgttc atcgaagacc gccatctgct cgatagcgac       540
     cagccgaacc gtaatcctgc gatcgactgg gggcgcttca gccgtgcgct gatggatcag       600
     gggctgcggg ttttcaacca tacccagccg cagccaggcg gcagcacgct cgccacgcag       660
     atcgagaaat tccgccattc gcccggcggc cgcactgcga cgccaaagga aaagctccgg       720
     cagatcgcgt cggcgtccgt gcgcgcctat ctcgacggtc cgcgcacgat gcccgcacgc       780
     gagcagatag tggtgcgcta cctgaattcg gtgccgctcg ccgcccagcc aggcatcggc       840
     gaagtgaacg gcatcggcga tggacttgcc gcctggtacg gccgcgactt cgcagaagtg       900
     aaccgcgtgc tgaaagcgcc gccgacgccc gagaatcttc ctgagcaggg gcttgcattc       960
     cgtcaggtgc tgtcgctgat gatcgcgcag cgcggaccgt cgcattttct gctgcgcaag      1020
     aacgatgaac tcaatgctct gacggaaagc tatctgcgga tcttcgcgac gaatggcgtg      1080
     atcacgccgc aactgcgcga cgccgcgctc gcgcaacaac tcgtgctgac acgcgcgaag      1140
     gtcgcgacgc ccgaaggctc gttcatcgag cgcaaagcgg tgacgtcgtt gcgcacgcat      1200
     ctgctgtcgt cgctcggcgt gtcgaatctg tacgacctcg accggctcga cgttcgcgtg      1260
     acgtcgacga tgaacaacca ggttcagcag gccatcagtg atcgtctcgc cgccgccacg      1320
     accaaggacg gcgcgcaagc agcggggctt tatggcttca acatgctgca gccgaaggac      1380
     gacccgtcga agatcgcgtt cagcttcacg ctgttcgaaa agcgcgacgg cgtgaacctg      1440
     ttgcgcgtgc agacggatag cgtcaaccgc ccgttcgata tcaattccgg cgcgcgcttg      1500
     aatctcggtt cgacggcgaa gttgcgcacg atcatcacgt atctgcagat catgtcggaa      1560
     ctgcatgcgc gctatggcca gatgagcgtc gatgaactgc gcgccgtgaa gcccgagcgc      1620
     gaagacgcct tgacgcgctg ggcggtcgac tatttcatgc acaccaacga ccgctcgctt      1680
     ccggcgatgc tcgatgcgtc ggtggagcgc aagtattcgg caaatgcggg cgaaaccttt      1740
     ttcacgggag gcggcgcaca gaccttcacg aacttcgaag ccgacgagaa ctcgcgcatc      1800
     ctcacggtgc atcaggcttt ccagcattcg gtgaatctgg tgttcgtgcg gatcatgcgc      1860
     gacatcgtcc actatgaaac gatcaagacg tctggcccgt catcgcaatg gctcagcgat      1920
     cctgatacgc gcaagatgta cctgacgcgc ttcgccgatc aggaaagccg cgtgtacatg      1980
     aatcgcttct acacgaagta tcacggcaag actcaggacg agatgcttgc cgttcttctg      2040
     cgcggcgtac gcaagtcgcc tccgaaagtt gcgaccgtcc tgcgcagcgt gcggcccgat      2100
     gcaccgcagg cgtggttcaa cagccagatg cgcgccgcac tgaagaacac gccgaaagcg      2160
     aatccgcctg acgacgcgct cgcggagctc tatgcgaagt atgcgatcga taaattcaac      2220
     ctgaacgacc gcgcatacat ttctagcgtg catccgctgg aactgtggct cgtcaattat      2280
     ctacgcgagc gtcccgaggc aagtgcgaac gacgtgatgg aggctagccg cgaggtgcgc      2340
     gccgatgcat acaagtggct cttcaagacg cgctatcacg cgacgcagga tcgtcgcatt      2400
     cgccgcatgg tcgagcagca tgcgtacgat gcgatcggca aatcgtggca ggcgcttggc      2460
     tatccgtttg cgcatctgac gccttcgtat gcggcggcga tcggtgcatc gggggaccgg      2520
     cccgcagcgc tggcccagtt gatcggcgtg attgcgaaca aggggaatca ggcgccgacg      2580
     cagagcttga gtgagcttga gtttgcgaag ggcacgccgt acgagacgcg cttcgtgcgc      2640
     gcgacgccgc agccgaacga ggcgatttcg cctgagattg cgcgggtcgc gcaagccatg      2700
     atgcgcgatg tcgtcgctgg gggaacggct aagcgccttg ctggtgggat gacgtttccg      2760
     aatgggacga cgcttgaggt ctatggcaag acggggactg gcgatcagcg gctcaatatc      2820
     tatgcgaagg ggcggcgtct gatcgagtcg cgcaaggtta atcgtacggc gacttttgtc      2880
     tttgctatcg gcgatcggtt ttttggcacc ttgactgccg tcgtgcatga gccttatgcc      2940
     aagcggtatg acttcaccag cgcccttgca gtgcaattgc tgaagtcgat ggctgctgaa      3000
     ttgcagccct tactggatcc gtctaccgat gcgggtggca gtaccactgc gtcccgatag      3060
//

If you have problems or comments...

PBIL Back to PBIL home page