(data stored in ACNUC29543 zone)

EMBL: CP001044.PE469

CP001044.PE469       Location/Qualifiers
FT   CDS_pept        complement(545768..548602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3599"
FT                   /product="diguanylate cyclase/phosphodiesterase with GAF
FT                   sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; GAF domain protein;
FT                   KEGG: psb:Psyr_2432 GGDEF"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3599"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72738"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM48"
FT                   /protein_id="ACC72738.1"
FT                   /translation="MWNADLSADGTQAQLIDQAAHAAEAAGAPWAWYRAGQHLELVREG
FT                   AARFDWPRSIVPAMLHDACVEYGWFAWPTGRRDLALGWLLAPASCAGDSAFAAFARVIG
FT                   EQMQADALMRAQNVQRVLYDIAYLASSISERGEFLQAIHERLGTLIDAENFYLALYDRE
FT                   TGAVTYPYYIDLIDTEAVDTNHMDMVDRERLSLTGYVLTTGQPLLIDEKGIIEASARGR
FT                   FHCVGHRPKFWMGAPLKNASDEVFGMVTMQVYDATRIYSAEDRALFLVVARHVAMALDR
FT                   ILHRVGLEAEVARRTAELSRLNDTLRAEIAERERAQHLQAALFEIAELSSQSVEIGKFF
FT                   RSLHEIVGGLLYAKNFYVALFDPATAEVSFPYYIDETQQEVPTSRRRERGLTEYVIRQR
FT                   VPCLFDTSDAVRLVEAGEIKLDSENIRLRSWLGVPLFDGIVVRGVLVVQSYSSSVNYDR
FT                   RDQELLTFVSRHIDTALSRRRVAEAQQAANLELEARVLARTQELDAANARLLHENYHDA
FT                   LTGLPNRSHLYERLAAAWLGYSSRGEPLSVLFIDLDRFKVVNDSLGHLFGDALLVEVAG
FT                   RLRDCLRRDDLLARLGGDEFAVVVPGASLQTVLTLAERILAAFDTPFNIGEQTVFTSCS
FT                   VGVVSADSAHHREPADLLRDADAAMYRVKNRGRDSFAVFNQQMRRELSDQIETEGALRN
FT                   ALKRDGELVPYFQPIVDIASGELVALEALIRWQQPNGEVWAPGRFLPAVEGLKLIGRLD
FT                   MYMLTRVAEILAQREHIDWPPVQVNLSSYSMTRPEFAEELLELLKRYGVHPSRVSLELT
FT                   EGALVAEPDLARNTMQSLADNGMSVVLDDFGTGFSSLSYVHQYRFSGLKIDKSFVLELT
FT                   QSARSRAIVRAIVRMAESLELTVVAEGIEDQATLDLLRTIGAAHGQGYHLARPMSLEAL
FT                   MGSASAPRLRVLAQ"
     atgtggaatg ccgatctgtc ggcagacggt acgcaagcgc agttgatcga ccaggcggcg        60
     cacgcggccg aggcagccgg cgcgccttgg gcgtggtacc gggcgggcca gcatctggaa       120
     ctcgtacgcg aaggcgcggc gcggttcgac tggccgcgct ccatcgtgcc cgcgatgctg       180
     cacgacgcct gcgtcgagta cggctggttc gcgtggccga ctggccgcag ggatctcgcg       240
     ctcggctggc tgcttgcgcc cgcgtcgtgc gcgggcgact ccgcatttgc cgcgttcgcg       300
     cgcgtgatcg gcgaacaaat gcaggccgat gcactgatgc gcgcgcaaaa cgtgcagcgc       360
     gtgctgtacg acatcgcgta tctcgccagc tcgatcagcg agcgcggcga atttctgcag       420
     gcgattcacg agcgtctcgg tacgctgatc gacgctgaga atttctatct cgcactttac       480
     gaccgtgaaa cgggcgccgt cacctatccg tactacattg acctgatcga taccgaagcc       540
     gtcgatacga accacatgga catggtcgac cgggagcggc tctcgctgac gggttacgtg       600
     ctgacgacgg ggcagccgct gctgatcgac gagaagggca tcatcgaggc aagtgcgagg       660
     gggcgctttc attgtgtcgg gcatcggccg aagttctgga tgggcgcgcc gctgaagaat       720
     gcgtcggacg aagtgttcgg catggtgacg atgcaggtgt acgacgcgac gcgcatctat       780
     agcgccgagg accgtgcgct ctttctggtt gttgcgcggc acgtggcgat ggcgctcgac       840
     cgcattctgc atcgcgtcgg gctcgaagcc gaggtcgcgc gccgaacggc tgagctttcg       900
     cgtctgaacg acacgctgcg cgcggagata gccgagcgcg agcgcgcgca gcatttacag       960
     gcggcgctgt tcgaaatcgc ggagctgtcg agtcagtccg tcgagatcgg caagttcttt      1020
     cgcagtctgc acgagatcgt cggcgggctg ctgtacgcga agaacttcta cgttgcgctg      1080
     ttcgatcccg cgacggcgga ggtgtcgttt ccgtattaca tcgacgaaac gcagcaggaa      1140
     gtgccgacgt cgcggcgccg cgagcgcgga cttacggagt acgtgatccg tcagcgcgtg      1200
     ccgtgtctgt ttgacacgag cgatgccgtg cgccttgtcg aagcgggcga gatcaagctg      1260
     gacagcgaga acatccgttt gcgctcgtgg ctcggcgtgc cgctcttcga cggcatcgtg      1320
     gtgcgcggcg tgctggtcgt gcagagttat tcgtcgagcg tgaattacga caggcgcgat      1380
     caggaactgc tgacattcgt gtcgcgccat atcgataccg cgttgtcgcg gcggcgtgtc      1440
     gcggaagcgc agcaggcggc gaatctcgaa cttgaagcgc gagtgctggc gcgcacgcag      1500
     gaactggacg ccgccaatgc gcggctcttg cacgagaact atcacgatgc gttgacgggc      1560
     ttgccgaacc gttcgcatct gtacgaacgg ctggcggcgg cgtggcttgg ctacagcagc      1620
     cgcggcgagc ctctttcggt gctgttcatc gacctggatc gcttcaaggt cgtcaacgac      1680
     agtctcggcc atttgttcgg cgatgcgttg ctcgtggaag tggcggggcg cttgcgcgac      1740
     tgtttgcggc gagacgatct gcttgcgcgg ctcggcggcg acgagttcgc cgtcgtcgtg      1800
     ccgggtgcga gcttgcagac ggtgctaacg ctggcggagc gcattcttgc ggcgttcgac      1860
     acgccgttca atatcggcga gcagacggtg ttcacctcat gtagcgttgg tgtggtgagc      1920
     gcggatagtg cgcatcaccg ggagccggcc gatttgctgc gcgatgccga tgctgcgatg      1980
     tatcgcgtga agaatcgcgg gcgcgacagt ttcgcggtgt tcaatcagca gatgcgtcgc      2040
     gagctgtcgg accagatcga aacggagggc gcgctgcgca acgcgctgaa gcgcgacggc      2100
     gagctggtgc cgtattttca gcctattgtc gatatcgcca gtggcgagct ggttgcgctg      2160
     gaagcgctga ttcgctggca gcagccgaac ggcgaggtgt gggcgccggg gcgttttctg      2220
     cctgccgtgg agggattaaa gctgattggt cggctcgaca tgtacatgct gacgcgcgtg      2280
     gccgagattc ttgcgcagcg ggagcatatc gactggccgc ccgtgcaggt gaatctgtcg      2340
     agttacagca tgacgcgtcc agagttcgcg gaagagttgc tcgaactgtt gaagcgctat      2400
     ggcgtgcatc cttcgcgcgt ttcactcgaa ctgacggagg gtgcgctcgt tgccgagccg      2460
     gatcttgcgc gcaatacgat gcaaagtctt gccgataacg ggatgagtgt cgtgctcgac      2520
     gatttcggca cgggtttttc gtcgttgagc tatgtgcatc agtatcggtt cagtggctta      2580
     aagattgaca agtcattcgt gttggagctg acgcagagtg cgcggagccg ggcgatcgtg      2640
     cgggccatcg tgcggatggc ggagtcgctg gagttgacgg ttgttgcgga agggatcgag      2700
     gatcaggcga cgttggattt attgcggacg atcggtgctg cgcacgggca ggggtatcac      2760
     ctggcgcggc cgatgtcgct ggaggcgttg atgggatcgg cgtcggcgcc aaggttacgg      2820
     gtgttggcgc aatag                                                       2835
//

If you have problems or comments...

PBIL Back to PBIL home page