(data stored in ACNUC29543 zone)

EMBL: CP001044.PE47

CP001044.PE47        Location/Qualifiers
FT   CDS_pept        complement(44904..46019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3148"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: asa:ASA_0507
FT                   outer membrane protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3148"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72316"
FT                   /db_xref="GOA:B2JRI9"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRI9"
FT                   /protein_id="ACC72316.1"
FT                   /translation="MKTPKLRGPVFMTLAATLAAVIAAPAFAESISSQVKALTPLAQRI
FT                   ADPYRRGAAEGFLEIAERQDSHVLVSNVYNDAANRALGNARFLIDNGAPWQGLYAAKNW
FT                   PTRDKWVQAIRSIEATNARAASSTCKGESAGRLLALTDEVWKEQDETHGTHWVHGWEAI
FT                   ERAKKLSVQVNDELDHCAPPPPPPPAADSPLPEKPISLSADALFDFDSAKLKAEGFEAV
FT                   DVLASNLKRVKAIDVVTVIGYTDRFGSVAHNRDLSRRRAQAVADALKQRGVDPGHFDVR
FT                   GAGSTAPVVTCPGPKKPAVIECLAPNRRVEIRVSGQTAASVPTPDAGSQRFAQAPQPVQ
FT                   PARVRPQAQQQLQLRKQWQMPAQSQPAPQQP"
     atgaaaacac caaaactacg cggcccggtc ttcatgacgc tcgccgcgac actggcggcg        60
     gttattgccg cgccggcgtt cgcggaaagc atctcgagtc aggtcaaggc gctgacacca       120
     ctggcgcagc gcatcgccga tccctatcga cgcggggcgg ccgaaggctt cctcgaaatc       180
     gcggagcggc aggatagtca tgtcctcgtt tcgaatgtgt ataacgatgc ggcgaaccgt       240
     gcgctcggca acgcgcgctt tctgatcgac aacggcgcgc cgtggcaggg gttgtacgcg       300
     gcgaagaact ggccgactcg cgacaagtgg gtgcaggcca tccgttcgat cgaagcaacc       360
     aacgcccgcg ctgcgtcatc gacgtgcaag ggcgaatcgg ccgggcgtct gctcgcgttg       420
     acggacgaag tctggaaaga gcaggacgaa acgcacggca cgcactgggt gcacggctgg       480
     gaggcgatcg agcgcgcgaa gaagctgagc gtgcaggtca acgacgaact cgaccattgc       540
     gcaccgccgc ctccgccgcc tccggctgcg gactcgccgt tgcccgagaa gccgatctcg       600
     ctgtccgcgg atgcgctgtt cgatttcgac agcgcgaagc tgaaggcgga aggcttcgag       660
     gccgtcgacg tgctcgcgtc gaacctgaag cgtgtgaagg ccatcgacgt cgtcaccgtg       720
     atcggctaca cagaccgctt cggctcggtc gcgcacaacc gcgacctgtc gcggcgtcgc       780
     gcccaggccg tcgccgacgc gttgaagcag cgcggcgtgg atcctgggca cttcgacgtg       840
     cgcggcgcgg gttcgacggc gcctgtagtc acgtgtccgg gcccgaagaa gcctgccgtc       900
     atcgagtgtc tggcgcctaa ccggcgcgtg gagattcgcg tgagcgggca gacagccgct       960
     tccgtgccca cgcccgatgc gggctcgcaa cggtttgcgc aagcaccgca gccggtgcag      1020
     cccgcgcgtg tccggccgca agcgcaacag cagctgcagt tgcgcaaaca gtggcagatg      1080
     ccggcacagt cgcaacctgc gccgcagcag ccatag                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page