(data stored in ACNUC29543 zone)

EMBL: CP001044.PE475

CP001044.PE475       Location/Qualifiers
FT   CDS_pept        553786..554232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3605"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_7040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3605"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72744"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM54"
FT                   /protein_id="ACC72744.1"
FT                   /translation="MTKVFIHSITVLAAVGAGLCSEPAFALELDGQLVCKSDAHTFIQP
FT                   LLDDQYIDPNPMRVEANSVNAFRPKRGRDLTAFGFHVYAVLGYQRDDAIFRQGSGAVEA
FT                   NSIYGVVVSGPSESVRVRVQQAGSEATVKQVLPFVLTAIVCSAG"
     atgacaaagg tcttcatcca ctcgattacc gtgctggccg ccgttggcgc aggactctgc        60
     agcgagcccg cgttcgcgct cgagctcgac ggacaactgg tgtgcaagag cgatgcgcac       120
     acgttcattc agccgttgct cgacgatcaa tatatcgatc ccaacccgat gcgcgtcgag       180
     gccaactcgg tcaatgcgtt ccgcccgaag cgcggccgcg atctcaccgc attcggcttt       240
     cacgtgtatg ccgtgctcgg ctaccagcgc gacgacgcga tcttccggca aggcagcggg       300
     gcagtcgaag ccaattcgat ctatggcgtg gtggtatccg gtccttccga gtcggtgcgc       360
     gtacgcgtgc agcaggcggg tagcgaagcg accgtcaagc aggttctgcc gttcgttctg       420
     acggcgatcg tgtgcagcgc agggtaa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page