(data stored in ACNUC29543 zone)

EMBL: CP001044.PE478

CP001044.PE478       Location/Qualifiers
FT   CDS_pept        556582..556920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3608"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72747"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM57"
FT                   /protein_id="ACC72747.1"
FT                   /translation="MFDAEIAATLLNRWTVKPPSAHGDSYLDLLREGNLNFTHQMGSVT
FT                   PGGVASASLFELESLEFVDGSRALRLKTPGSMSGWTQWAAFEPPARNMANAPAQRSEES
FT                   CTLEAPER"
     atgttcgatg ccgaaatcgc cgcaacgctg ctgaaccggt ggacggtcaa gccgccctcc        60
     gcgcatggcg acagctatct ggacctgctg cgcgagggaa atttgaactt cacgcatcag       120
     atgggaagtg tgacgccggg cggcgtcgcg tctgcgagtc tgttcgaact cgaatcgctc       180
     gaattcgtcg acggttcgcg cgcgctgcgt ctgaaaacac cgggctcgat gtccggctgg       240
     acgcaatggg ccgcgttcga gccgcccgct cgaaacatgg caaacgcacc cgcgcagcgt       300
     tccgaagagt catgcacgct cgaagcgccc gagcgctga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page