(data stored in ACNUC29543 zone)

EMBL: CP001044.PE48

CP001044.PE48        Location/Qualifiers
FT   CDS_pept        complement(46071..54677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3149"
FT                   /product="Haemagluttinin domain protein"
FT                   /note="PFAM: YadA domain protein; Haemagluttinin domain
FT                   protein; Hep_Hag repeat-containing protein; KEGG:
FT                   bxe:Bxe_A0586 putative membrane-anchored cell surface
FT                   protein, haemagluttinin"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3149"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72317"
FT                   /db_xref="GOA:B2JRJ0"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRJ0"
FT                   /protein_id="ACC72317.1"
FT                   /translation="MNKTYRSVWNESTGTWVAVQENAKGRRKKAAQSAVALLAAGAGLT
FT                   SSLAHAGALDGGYAPGYGASSLGYASSATGDYSTALGSFTNASGNWSTAVGNQSTASGF
FT                   ASAAFGDSAIASAQYATALGQNTYASGAGATAVGQNARATGYVSSSLGYASSSSGSWST
FT                   ALGSFATATGDWSTGVGNQATATGFSAAAFGDSAVASANYATALGQAAHASGTGSSAVG
FT                   QDATSVGAYSVALGESASATTSKSVALGAYSVANSTTLSSAGFEPGGAVISAASAAGGE
FT                   MSVGSAGAERRVTNVAAGLNGTDAVNVSQLMAEDARVNVLSNTVNNIGNNGNGGTIKYF
FT                   HANSTAADSAASGQNSIAVGPQALASNSYGIAMGPLATASGVSGVAIGAASLSTAQQSD
FT                   AFGDYATASGLYSVALGNQSTASAQSALAVGDTAIASGVNSSAIGRQATASTSNSVALG
FT                   ANSIASSTTLGSAGFNPGGASINASTAVGEVSIGSANAERRLTNVAAGYSATDAVNVSQ
FT                   LMSEDAKVNAEGAATAAALGGGSSYNSTTGAITNPTYNISGGTYNNVAGALTSIDARIN
FT                   NIGNGSSGGNLKYFHANSSLADSTATGVDSVVAGPAATASANSAVALGADSVADRDNTV
FT                   SVGSSTAQRQITNMAAGTAATDAVNVSQLTGVTTAIGGGASVKADGTIAQPTFNVYGQT
FT                   YSNVGDALASINNNTGNIVQNLKYIKFGASTAAAAQAGGTDSIAIGGNAVATANGAIAI
FT                   GRGANATASNSVALGVNSVANTANTFAVGSAVLTRRIVNVADGTATTDAATVGQVNADI
FT                   QAAIASLQTPLTSKPALLGSTPTLRSTQLLGATSSLTPDQLIFSGPTDKAGMTYAQGQD
FT                   SIAIGLNSQATADYAVAIGDNAQSLDNSTVAIGQTAITDGQSAVAIGSQVSANGSYAIA
FT                   IGNNGTLAQADNAIAIGNNVQVGGVNTMAVGENIVSTGTNSIVLGYASADGGRANVLSV
FT                   GSSTQQRQIVNVAAGTQNTDAVNVSQLKGAVSALGGGATVNPTTGVVTAPAYNVAGGTY
FT                   VNVGAALSALDAGEKAISNNVMNVTNVVNNITNGGGIKYFHTNSTLADSLANGANSVAI
FT                   GGNAVATTSNSVALGSNSVASAATLSSAGFAPGGFSISATTATGEVSVGAQGAERRVTN
FT                   IAAGYAATDAVNVSQLMAEDQRVNVVSNNLSNLSNVVNNLGGSINLKYFHSNSTLTDST
FT                   ASGTDAVAVGPQATAAGTSAIAIGNSASATAANSVALGSNATTTANLSAAAYNPGSATL
FT                   SGTTASGEVSVGNASFNRRITNVAAGSAATDAVNVSQLMSEDAKVNAEGAGTAAALGGG
FT                   SSYNASTGAITNPTYNVSGGTYNNIAGALTGIDARVTNMGNNITYLNNVINNTIINGGG
FT                   IKYFHANSTLADSTASGTDSVAIGGAASASASNSVALGSNATTTANLSAAAYNPGSTTL
FT                   SGTTAAGEVSVGNAGLNRRITNLAAGSAATDAVNVSQLMSEDAKVNAEGAATAAALGGG
FT                   SSYNPSTGAITNPTYNVAGATTNNVGGALTSIDARINNIQVGGGIKYFHANSTLADSTA
FT                   SGMNSVAIGGAAMASASNSVALGANSLANSSTLASTGFAPGGLTISAGTAAGEVSVGTS
FT                   GAERRITNVAAGYSATDAVNLSQLMAEDAKVNNVSNNLTNLSNIVNNISGGSNLKYFQV
FT                   NSSLANASATGTDSVAAGPNAVATASNAVALGANSVADRANTVSVGSSGSQRQIVNLAA
FT                   GTNPTDAVNVSQLAGVTAALGGGATVNPTTGAIVAPAYNVLGNTYSNVGSALSAFLDAS
FT                   SNLQTSLKYINFGPSTAAKSQASGTDAIAIGGNAVATANGAVAIGRGANATASNSVALG
FT                   VNSVANTANTFAVGSAVSTRRIVNVADGTAATDAATVGQVNADIQTAITNLQTSLASKP
FT                   ALLGSAPAVRSTQLVGAVGGAFPSPSSLTPDQLIFSGPTDKVGMTYAEGQDSMAIGLNS
FT                   QATADYAVAIGDNAQSLDNSAVAIGQTAITDGQSAVAIGSQVSANGDYAIAIGNNGTLV
FT                   QGANDMAIGNNVQVGGVNTMAIGENIVTTGTNDVVLGYASTDGGRANIVSVGSNTQQRQ
FT                   IINVAAGTQKTDAVNVSQLSGVTTALGGGASVNPTTGAVVAPAYSLAGSTYSNVGAALS
FT                   SLDTRIASSGDPLAVDYDAAAKNQITLKGASGTKISGLMAGALNATSSEAVNGSQLYAQ
FT                   GVSTAQALGGGASVNTTTGAITAPQYTFGGATYTNVGDALTALNNAAGSGNALGVVYNA
FT                   QDKSEITLAGANGTKIDKLAAGDVNASSSDAVNGAQLYNVAASAANAIGGGSTVNNDGT
FT                   ISNPTYVVGGSTVTTIGGAITNLDARVYANSTDITNLQTQINEGGIGLVTQDATSKNIL
FT                   VASATGGSLVDFTGTAGARRLTGVAAGNVSASSLEAVNGTQLYNVAASAANAIGGGSTV
FT                   NNDGTISNPTYVVGGSTVTTIGGAITNLDARVYANSTDITNLQTQINEGGIGMVTQDQP
FT                   GSNILVASKTDGSVVDFTGTAGARILSGVAAGVAATDAVNVGQLQAAGIIDPNGKTKAA
FT                   VTYDTNANGSTDYSSITLGDGTANAAPVTIHNVAAGTQSNDAVNYSQYAALQAQVNNIT
FT                   NAGTGVDTLFVGDGDRNTEAAQAGGTHATAMGALSVANGTQSVAAGYASNASGQNAVAM
FT                   GANASASGNNAVALGAGSVADQDNTVSVGSATQQRRVTNVAAGTASTDAVNVGQLNEAI
FT                   AQANASVDDKVSQGVQSANAYTNQQINNLDKKMNSLGAAAMAATSLIPNARAEGNFQMS
FT                   AAAGTYGGAAAIALGANYWVNDRLLVNAHVTRSTGYGASTGASVGATFGF"
     atgaataaga cttatcgatc ggtttggaac gagtcgaccg ggacttgggt tgctgttcag        60
     gaaaatgcaa agggaaggcg aaagaaggcg gcgcaaagtg cggtagcgct tttggcagcg       120
     ggtgcaggcc tgacttcttc gctggcacac gcgggtgctc ttgacggcgg atatgcaccc       180
     ggatacggcg cgtcatcgct cgggtatgca tcgagcgcca cgggcgatta ttcgacggct       240
     ttgggttcgt ttacaaatgc ttccggcaat tggtcgaccg ctgtaggcaa tcagagcacc       300
     gcgtcgggct ttgcctcagc agcctttggc gattctgcga ttgcctcggc gcaatatgcg       360
     accgcactgg gccagaatac atacgcgtcg ggagccgggg ccaccgcggt agggcagaac       420
     gcgcgtgcga cgggatacgt ttcatcatcg ctcgggtatg catcgagttc cagtggcagt       480
     tggtcgacgg cgcttggcag ttttgcaact gccacaggtg actggtcaac tggcgtcggc       540
     aatcaggcta ctgcaaccgg gttttctgcg gcggcttttg gcgattcagc tgtagccagc       600
     gcgaactatg caactgcgtt ggggcaggcg gctcatgctt ctggaaccgg gtcgagcgca       660
     gtcgggcaag acgcaacttc ggtaggggca tattccgttg cactgggtga gtcggcgtct       720
     gcaaccacgt ccaaatcagt cgcgcttggc gcatactctg ttgccaattc gaccaccctg       780
     tcgtcggcgg gcttcgagcc aggcggcgcg gtaatttctg cggcgtcggc cgcgggtggc       840
     gaaatgtcgg tcggttcagc cggagcggaa cgtcgcgtta cgaacgttgc tgcaggcctg       900
     aacggcacgg acgctgtcaa cgttagccag ttgatggcgg aagacgcccg ggtcaacgtt       960
     ctcagcaaca cagtcaacaa cattggcaac aacggcaacg gcggtacgat caagtacttc      1020
     cacgcgaact cgacggccgc cgactccgcg gcatccggcc agaattcgat cgcagtcggc      1080
     cctcaggcgc ttgcatcgaa ttcgtacggg attgcaatgg gcccgcttgc cacggcatcg      1140
     ggtgtttccg gcgttgcaat tggcgcagct tcactttcga ccgctcaaca gagcgatgcc      1200
     ttcggcgact atgcgaccgc gagcggactt tattccgttg cgctgggcaa tcaatcgacg      1260
     gcatccgcgc aaagcgcatt ggccgttggc gacacggcga tcgcgtccgg ggtgaactcg      1320
     agcgccattg gccgacaggc gacggcttcg acatcgaatt cggttgcatt gggcgcgaac      1380
     tcaatcgcga gctcgacgac gctcggctcg gccggcttca acccaggcgg cgcgtccatc      1440
     aatgcttcga cggctgtggg cgaagtgtcc atcggttcgg caaacgcaga gcgtcgcctc      1500
     acaaacgtcg cagcgggtta ctcggccacg gacgccgtga acgtcagcca gctgatgtcg      1560
     gaagacgcga aggtcaacgc cgagggcgca gcgacggcag cggcgctggg cggcggttcc      1620
     tcgtacaact cgacgacggg cgcgatcacg aacccgacgt acaacatctc gggcggaacg      1680
     tataacaacg ttgcaggcgc gctgaccagc atcgatgcgc gcatcaacaa catcggcaat      1740
     ggcagcagcg gcggcaatct gaagtacttc cacgcgaact cgtcgctggc cgactcgacc      1800
     gcgacgggcg tcgacagcgt cgttgccggt ccggctgcaa cggccagcgc aaatagcgcg      1860
     gtcgcgcttg gcgccgactc ggtggcggat cgcgataaca cggtttctgt cggttcgtcg      1920
     acggctcagc gtcagatcac gaacatggcg gcaggtacgg ccgcaaccga cgcagtcaac      1980
     gtttcgcaac tgacgggagt gacgacggca atcggcggtg gcgcatcggt gaaagccgac      2040
     ggcaccatcg cacagccgac gttcaacgtg tacggccaga cgtactcgaa cgtcggcgat      2100
     gcgctcgcca gcatcaacaa caacacgggc aacatcgttc agaacctgaa gtacatcaag      2160
     ttcggcgcaa gtacggcagc tgcggcacag gcggggggca ccgactcgat tgcgattggc      2220
     ggcaatgcgg tcgcgacggc gaatggcgca atcgctatcg gtcgcggcgc gaatgcgacg      2280
     gcttcgaatt cggtggcgct cggcgtcaac tccgtggcaa acacggccaa cacgtttgcg      2340
     gtcggcagcg ccgtgttgac gcgtcgaatc gtcaacgtcg cggacggcac ggcgaccacc      2400
     gatgcggcca cggttggcca ggtcaacgcg gacattcagg cggctatcgc cagtttgcaa      2460
     accccattga cgtcgaagcc cgcgttgctg ggatcgactc ccaccctccg ttccacccaa      2520
     ctgctcggtg ctacgtcgag tctgacgccg gatcaactga tcttctccgg tcccaccgat      2580
     aaggccggga tgacctatgc tcaaggccag gattcaatag cgatcggcct gaactcgcag      2640
     gcgacggctg actacgcagt cgcgatcggc gacaacgcac agtcgctgga caacagcacg      2700
     gtcgccatcg ggcagacggc gattacggac ggacagagcg cggtcgccat cggttcgcaa      2760
     gtgtcggcga acggcagcta cgccattgca atcggcaaca atggcacttt ggcgcaagcc      2820
     gataacgcca ttgcgattgg taacaacgtg caggtcggcg gcgtcaacac gatggccgtt      2880
     ggcgagaaca tcgtttcgac gggtaccaac agcatcgtat tgggctacgc cagcgcggac      2940
     ggcggacgcg caaacgtcct gtcagtgggc agcagcacgc agcagcgtca gatcgtcaat      3000
     gtcgctgccg gtacgcagaa caccgacgcc gtgaacgtct cgcagctcaa gggtgccgtc      3060
     agcgcactcg gcggtggcgc aacggtcaac ccgacgacgg gcgtagtcac ggcaccggcg      3120
     tacaacgtcg ccggtgggac ttacgtcaac gtaggcgctg cgttgtcggc gctcgatgcg      3180
     ggcgagaagg ccatttcgaa caacgtgatg aacgtgacga acgtggtgaa caacatcacg      3240
     aacggaggtg gcatcaagta cttccacacc aactcgacgc tggcggactc gttggcgaac      3300
     ggtgcgaact ctgttgcaat cggcggtaac gcagttgcga cgacgtcgaa ttccgtcgcg      3360
     ctcggcagca actccgtcgc cagcgcggct acgctgtcgt cggccggctt cgcgccgggc      3420
     ggcttctcta tctcggccac aacggctacg ggcgaagtgt cggttggtgc gcaaggtgca      3480
     gagcgtcgcg tcacgaacat cgcggcaggc tatgcggcaa ccgacgcggt caacgtcagc      3540
     cagctgatgg cggaagacca gcgggtcaac gttgtcagca acaacctgag caacctcagc      3600
     aacgtcgtca acaaccttgg cggcagcatc aacctgaagt acttccattc gaattcgacg      3660
     ctgaccgact cgacggcatc gggaacggat gcggttgccg tgggtccgca agctacagcg      3720
     gcgggcacga gcgcgatcgc gatcggtaac agcgcgagcg caacggcagc gaactccgtc      3780
     gcgctgggct cgaacgcgac gacgacggcg aacctgtcgg cagccgcgta caaccccggt      3840
     agcgcgacac tgtcgggcac gacggcgtcg ggcgaagtgt cggtcggcaa tgcaagcttc      3900
     aatcgccgca tcaccaacgt cgcagcaggt tcggctgcga cggatgccgt gaacgtcagc      3960
     cagttgatgt cggaagatgc aaaggtcaac gccgagggcg caggaacggc agcggcgctg      4020
     ggcggcggtt cgtcctacaa cgcgtcgacg ggcgcaatca cgaacccgac gtacaacgtt      4080
     tcgggcggta cctacaacaa tatcgcaggt gcgctgacag gcattgatgc ccgtgtgacg      4140
     aacatgggca acaacatcac gtacctcaac aacgtcatca acaacaccat catcaacggt      4200
     ggtggcatca agtacttcca cgcgaattcg acgctggccg actcgaccgc atcaggcacg      4260
     gattcggtcg caatcggcgg tgcagccagc gcttcggcgt cgaactcggt tgcactcggc      4320
     tccaacgcga cgacgacggc caatctgtcg gcagccgcgt acaacccggg cagcaccacg      4380
     ctgtcaggca cgacggcagc aggtgaagtt tcggtgggca atgcaggtct gaatcgccgc      4440
     atcactaacc tcgcagccgg ctcggcggca acggacgcag tgaacgtcag ccagttgatg      4500
     tctgaagacg ccaaggtcaa cgcggaaggc gcggcgacgg cagcggcgct gggcggcggt      4560
     tcgtcgtata acccgtcgac gggcgcaatc acgaacccga cgtacaacgt ggcgggtgca      4620
     acgaccaaca acgttggcgg cgcgctgacc agcatcgatg cgcgcatcaa caacatccag      4680
     gtcggcggtg gcatcaagta cttccatgca aactcgacgc tggcggactc gacggcatcg      4740
     ggcatgaact cggtggcaat cggcggcgca gcgatggctt cggcatcgaa ctcggtggcg      4800
     ctgggtgcga actcgcttgc aaactcgtca acgcttgctt cgaccggctt tgcgccgggc      4860
     ggcctgacga tttcggcggg tacggccgcg ggtgaagtgt ccgtcggcac atcgggcgcg      4920
     gaacgccgca tcacgaatgt cgcggccggc tactcggcaa cggatgcagt gaacctgagc      4980
     cagttgatgg cggaagacgc gaaggtcaac aacgtcagca acaacctgac gaacctgtcg      5040
     aatatcgtca acaacatcag cggcggctcg aatctgaagt acttccaggt gaattcgtcg      5100
     ctggcgaatg catcggcaac gggtacggat agcgtcgcgg caggcccgaa cgcggtggcg      5160
     acggcaagca acgcagtcgc gctgggcgcg aactcggtgg ccgatcgcgc taacacggtg      5220
     tccgtcggtt cgtcgggctc gcagcgccag atcgtgaacc ttgcagccgg cacgaacccg      5280
     acggatgcgg tcaacgtgtc gcaactcgcg ggtgttacgg ctgcactggg cggcggggcg      5340
     acggtcaacc cgacgacggg cgcgatcgta gcgccggcgt acaacgtgct tggcaatacg      5400
     tactctaatg tgggttccgc actgtcggcc ttcctggacg cgtcgagcaa cctgcaaacg      5460
     agcctgaagt acatcaattt cggcccgagc acggcagcaa aatcccaggc atcgggtacg      5520
     gatgcaatcg cgattggcgg caatgcggtc gcaacggcca acggcgcagt cgctatcggt      5580
     cgcggcgcga atgcgacggc ttcgaattcg gtggcgctcg gcgtcaactc cgtggcaaac      5640
     acggccaaca cgttcgcggt tggcagcgcc gtgtcgacgc gtcgaatcgt caacgtcgcg      5700
     gacggcacag cggccaccga tgcggccacg gttggccagg tcaacgcgga tattcagacg      5760
     gctattacca atctgcaaac ctcgcttgca tccaagcccg ccttgctggg ttccgcaccc      5820
     gccgtccggt cgacgcagct tgtcggcgca gtgggcggag cgttcccgtc gccgtccagc      5880
     ttgacgccgg atcagctgat cttctccggt cccaccgata aggtcggtat gacgtatgcc      5940
     gaaggccagg attcgatggc gatcggcctg aactcgcagg cgacagccga ctatgcagtc      6000
     gcgattggcg acaacgcaca atcgctggac aacagcgcgg tcgctattgg ccagacggcg      6060
     ataacggacg gacagagcgc tgtagcgatt ggttcacagg tcagtgcgaa cggcgactac      6120
     gcgattgcga tcggcaacaa cggtacgctg gtccaagggg ccaacgacat ggctatcggt      6180
     aacaacgtgc aggtcggtgg cgtgaatacg atggccattg gcgagaacat cgtgacgacc      6240
     ggcaccaacg atgtggtcct cggttacgcc agcacggacg gcggccgcgc gaacatcgtc      6300
     tccgtcggca gcaacacgca gcaacgccag atcatcaacg tcgctgcagg cacgcagaag      6360
     accgacgccg tcaacgtctc ccagctctct ggcgtgacga cggcgctcgg cggcggcgca      6420
     tcggtcaatc cgaccacggg cgcagtcgtg gcaccggcct actcgctggc gggcagcacc      6480
     tactccaacg taggcgcagc gttgtcgtcg ctggatacgc gcatcgcatc gagcggtgat      6540
     ccgctcgctg tcgattacga cgccgcggca aagaatcaga tcacgctgaa gggcgcaagc      6600
     ggcacgaaga tcagcggtct gatggcaggc gcgttgaacg caaccagctc ggaagccgtg      6660
     aacggttcgc agctgtatgc acagggtgta tcgacggctc aggcacttgg cggcggcgcg      6720
     tcggtcaata caacgacggg cgcgatcacg gctccgcagt acacgttcgg cggcgcgacg      6780
     tacaccaacg tcggtgatgc gctgacggct ctgaacaacg cagcgggttc gggcaatgca      6840
     ctgggcgtgg tctacaacgc ccaggacaag agtgagatca cgctggcagg cgcgaacggc      6900
     acgaagatcg acaagctggc ggcaggcgac gtgaacgcat ccagttcaga tgccgtgaac      6960
     ggcgcgcagc tgtacaacgt ggcggcatcg gcggcgaatg cgatcggcgg cggttcgacg      7020
     gtgaacaacg acggtacgat cagcaatccg acgtatgtcg ttggcggctc gaccgtcacg      7080
     acgatcggtg gcgcgatcac gaacctcgac gcccgtgtct atgcgaacag caccgacatc      7140
     acgaacctgc aaacgcagat caacgaaggc ggcatcggtc tcgtgacgca ggatgcgacg      7200
     agcaaaaaca tcctcgtcgc gtccgcgacg ggcggttcgc tcgtcgactt tacgggcacg      7260
     gctggtgctc gcaggctgac gggcgtggcg gcgggcaacg tgagtgcatc gagcctcgaa      7320
     gcggtgaacg gcacgcagct gtacaacgtg gcggcgtcgg cggcgaatgc gatcggcggc      7380
     ggttcgacgg tgaacaacga cggcacgatc agcaacccga cgtatgtcgt tggcggctcg      7440
     accgtcacga cgatcggcgg tgcgatcacg aacctcgacg cccgtgtcta tgcgaacagc      7500
     acggacatca ccaacctgca gacgcagatc aacgagggcg gcatcggcat ggtcacgcag      7560
     gaccagccgg gcagcaacat cctcgttgcg tcgaagaccg acggctcggt cgtcgacttc      7620
     acgggcacgg cgggcgcgcg catcctgtcg ggcgtggcgg caggggtggc ggcaaccgat      7680
     gcagtgaacg tcggacagct gcaagcggcc ggcattatcg accccaatgg caagaccaag      7740
     gccgccgtga cgtatgacac gaacgcgaac ggttcgaccg actacagcag catcacgctg      7800
     ggggacggta cggcgaacgc agcgcccgtg acaatccaca acgtcgcagc gggcacacag      7860
     tcgaacgatg ccgtcaacta ctcgcagtac gcggcgttgc aggcccaggt caacaacatc      7920
     acgaacgcgg gaacgggtgt cgatacgctg ttcgtcggcg acggcgaccg caacacggaa      7980
     gcagcgcagg caggcggcac gcacgccacg gcaatgggcg cgctgtccgt tgcaaacggc      8040
     acgcagtcgg tcgcggcggg ctatgcatcg aacgcgtcgg gccagaacgc cgtcgcaatg      8100
     ggtgcaaacg cgtcggccag cggcaacaac gccgttgcac tcggcgcggg ttccgtcgcg      8160
     gatcaggaca acacggtgtc ggtcggctcg gctacgcagc agcgccgggt cacgaacgtt      8220
     gccgcgggca ctgcgtccac ggacgccgtc aacgtcggtc agttgaacga ggcgattgcg      8280
     caggcaaacg catcggtcga cgacaaggtc agccagggtg tccagtccgc gaacgcgtac      8340
     acgaaccagc agatcaacaa cctcgacaag aagatgaact cgctcggcgc ggcggcgatg      8400
     gcggcaacgt cgctgatccc gaatgcacgg gcagagggca acttccagat gtcggcggct      8460
     gcaggtacgt atggcggcgc tgctgccatc gcgctcggtg cgaactattg ggtcaacgac      8520
     cgcttgctgg tgaacgcgca cgtgactcgc tcgacgggct acggcgcaag cacgggcgcc      8580
     tccgtcggcg cgacgttcgg gttctaa                                          8607
//

If you have problems or comments...

PBIL Back to PBIL home page