(data stored in ACNUC29543 zone)

EMBL: CP001044.PE482

CP001044.PE482       Location/Qualifiers
FT   CDS_pept        complement(560368..561396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3612"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: reu:Reut_B4671 2-dehydropantoate 2-reductase;
FT                   TIGRFAM: 2-dehydropantoate 2-reductase; PFAM: Ketopantoate
FT                   reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3612"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72751"
FT                   /db_xref="GOA:B2JM61"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM61"
FT                   /protein_id="ACC72751.1"
FT                   /translation="MKICVYGAGAIGAYVGAQLALAGADVSFVARGPHLAAMQKNGVRL
FT                   LIDDTERLVNVRCSSDPRELGPQDYVIIALKAHSVPGVVDAMQPLLGPETAIVTAVNGI
FT                   PYWYFYKHGGEFANSTLESIDPGGTQWKKLGPERAIGCVVYPAAEIVEPGVIKHVYGKK
FT                   FPIGEPDGTRTPRVEALSQMMVAAGLEAPIRDNIRDEIWLKLWGNLCFNPISALTHATL
FT                   DVITSHVGTRAVAKTMMLEAKSVAERFGVHFRVDVERRIDGAGAVGAHKTSMLQDLEAG
FT                   RPMEIDPLLTVVQEMGRLVGHETPTIDTVLALIKLREDVAQHRDVAPAAKTEQAAQSAK
FT                   AA"
     atgaagatct gtgtttatgg agcgggcgcc atcggcgctt atgtcggcgc gcaactggcg        60
     cttgcgggcg cggatgtcag tttcgtcgca cgcggtccgc atctggccgc gatgcagaag       120
     aacggcgtgc gtctgctgat cgacgatacg gaacgtctcg tcaatgtgcg ctgttcgtcg       180
     gatccgcgcg agctagggcc gcaggactac gtgattatcg cgttgaaggc gcattcggtg       240
     ccgggcgtcg tcgatgcgat gcagccgctg ctcgggccgg aaacagccat cgtgacggcc       300
     gtcaacggca ttccatactg gtacttctac aagcatggcg gcgagttcgc gaactcgacg       360
     ctggaaagca tcgacccggg cggcacgcag tggaagaagc ttggaccgga gcgcgcgatc       420
     ggttgcgtcg tctaccccgc tgcggaaatc gtcgagccgg gtgtgatcaa gcatgtgtac       480
     ggaaagaagt ttccgatcgg cgagccggac ggcacgcgca cgcctcgcgt cgaagcgctt       540
     tcgcagatga tggtcgcggc gggactcgaa gcgcccattc gcgacaacat ccgcgatgaa       600
     atctggctga aattgtgggg caatctctgc ttcaatccga tcagcgcgtt gacgcacgcg       660
     acgctcgacg tcatcacgag tcacgtcggc acgcgtgccg tcgcgaagac gatgatgctc       720
     gaagcgaagt cggtggccga gcggttcggt gtgcatttcc gcgtcgatgt ggagcggcgt       780
     atcgatggcg cgggcgccgt cggtgcgcac aagacctcga tgctgcagga tctcgaagcg       840
     ggacgtccga tggaaatcga tccgctgctg accgtcgtgc aggaaatggg gcgtctggtc       900
     gggcatgaaa ccccgaccat cgacaccgtg ctcgcgctga tcaaactgcg cgaggacgtt       960
     gcgcagcaca gggatgtcgc accggcagcc aaaaccgaac aggctgcgca gagcgcgaaa      1020
     gccgcataa                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page