(data stored in ACNUC29543 zone)

EMBL: CP001044.PE485

CP001044.PE485       Location/Qualifiers
FT   CDS_pept        complement(564529..564891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3615"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72754"
FT                   /db_xref="GOA:B2JM64"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM64"
FT                   /protein_id="ACC72754.1"
FT                   /translation="MRRASAPEVPVILLPEGGHVAGRFALRAVVYILFIAFAAIARRIS
FT                   MRVENFGPYQLELSAMQFIHNGGWAAFAEVRKLDDGAEVPIPVLPFQQVADHTVFATEA
FT                   AAIAAARGAVVAMISP"
     ttgaggcgcg cgtcggcgcc tgaggtgccg gttattttgt tgcccgaagg cggccacgtg        60
     gcgggtcgct ttgcgcttcg cgcagtcgtt tatatcttgt tcatcgcctt tgcggcgatc       120
     gcacggagaa tatcgatgcg tgtagaaaac tttggaccgt atcagctcga actgtctgcg       180
     atgcagttca ttcataacgg tggttgggct gctttcgcag aggttcgcaa gctggatgac       240
     ggggccgagg tgcccattcc cgttttgcct tttcaacagg tcgccgatca cactgttttt       300
     gccactgagg cagctgctat cgctgctgcg cgtggagctg ttgtggctat gatttcgccg       360
     tag                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page