(data stored in ACNUC29543 zone)

EMBL: CP001044.PE486

CP001044.PE486       Location/Qualifiers
FT   CDS_pept        complement(564869..565300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3616"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: bxe:Bxe_B2761 putative PAS/PAC sensor protein;
FT                   TIGRFAM: PAS sensor protein; PFAM: PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3616"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72755"
FT                   /db_xref="GOA:B2JM65"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM65"
FT                   /protein_id="ACC72755.1"
FT                   /translation="MQAAIDYEQLVNAIGDAVVISDKSGAITLWNPAAERMFGFTQEEA
FT                   LGKSLDLIIPERLRGRHWEGYEKTMSTGQTRYGHELLRVPSVHKDGRALSIAFTVALLY
FT                   SPERELTGVVAVIRDETARFQEDRSLRKRIAELEARVGA"
     atgcaagcag ccatcgacta tgaacaactg gtgaacgcga tcggcgatgc cgtcgtgatt        60
     tcggacaaga gcggcgcaat cacgctgtgg aatcccgcag ccgagcggat gttcggcttc       120
     acgcaggaag aagcactcgg caaatcgctg gatctgatca ttcccgaacg tcttcgcggg       180
     cgtcactggg aaggttacga aaagaccatg tcgacggggc agacgcgcta tggccacgaa       240
     ctgttgcgcg tgccttccgt tcacaaggac ggccgtgcgc tgtccattgc ttttaccgtt       300
     gcattgcttt actcacccga gcgcgagttg acgggcgtcg tcgcggtgat ccgcgatgaa       360
     accgcgcgct tccaggaaga ccgcagtctg cgcaagcgca tcgcggaact tgaggcgcgc       420
     gtcggcgcct ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page