(data stored in ACNUC29543 zone)

EMBL: CP001044.PE487

CP001044.PE487       Location/Qualifiers
FT   CDS_pept        complement(565423..566673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3617"
FT                   /product="formyl-CoA transferase"
FT                   /note="TIGRFAM: formyl-CoA transferase; PFAM: L-carnitine
FT                   dehydratase/bile acid-inducible protein F; KEGG:
FT                   bxe:Bxe_B2760 putative formyl-coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3617"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72756"
FT                   /db_xref="GOA:B2JM66"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR017659"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM66"
FT                   /protein_id="ACC72756.1"
FT                   /translation="MSKPLEGVKIIDFTHVQAGPACTQLLAWFGADVIKVERPGAGDVT
FT                   RNQLRDIPDADALYFTMLNSNKRSLTLDTKTQEGKEVLERLIKESDVLVENFAPGALDR
FT                   MGFTWERINELNPKMIVASVKGFSDGHHYDDLKVYENVAQCAGGAASTTGFWDGPPTVS
FT                   AAALGDSNTGMHLAIGILTALIGRDKTGKGQKVAVSMQDSVINLCRVKLRDQQRLDRVG
FT                   YLEEYPQYPHGEFTDVVPRGGNAGGGGQPGWVLKCKGWETDPNAYIYFTVQGHAWEPIC
FT                   RAIGKPEWIDDPAYMTAQARQPHIFDIFNTIEQWLADKTKFEAVDILRKFDIPCSPVLS
FT                   MKEIANDESLRKSGTIVEVDHKARGKYLTVGSPIKFSDMKPEITGSPLLGEHTEEVLAG
FT                   LGYSFEQIANMREAKVV"
     gtgagcaaac cactcgaagg cgtcaagatc atcgacttca cgcacgtcca ggcaggcccg        60
     gcgtgcaccc agttgcttgc ctggttcggc gcggatgtga tcaaggtcga acgccccggt       120
     gcaggcgacg tgacgcgcaa ccagttgcgc gacattcccg acgccgacgc gctgtacttc       180
     acgatgctca acagcaacaa gcgttcgctg acgctcgaca ccaagacgca ggaaggcaag       240
     gaagtgctcg aacgtctgat caaggagtcg gacgtgctgg tcgagaactt cgcaccgggc       300
     gcgctggacc gcatggggtt cacgtgggag cggatcaacg aactgaatcc gaagatgatc       360
     gtcgcctccg tcaagggctt cagcgacggt caccactacg acgacctgaa ggtctatgaa       420
     aacgtcgcgc agtgcgctgg cggcgcagcg tcgacgacgg gtttctggga cggcccgccg       480
     acggtcagcg cagcggcgct tggcgacagc aacacgggta tgcaccttgc catcggcatt       540
     ctcacggcgc tgatcggccg cgacaagacg ggcaagggcc agaaggtggc cgtgtcgatg       600
     caggacagcg tgatcaacct gtgccgcgtg aagctgcgcg accagcagcg tctggatcgc       660
     gtgggctacc tcgaagagta tccgcagtac ccgcacggcg aattcaccga tgtcgtgccg       720
     cgcggcggca atgcaggcgg cggcggtcag ccgggctggg tgctgaagtg caagggctgg       780
     gaaacagatc cgaacgcgta catctacttc acggttcagg gccacgcatg ggagccgatc       840
     tgccgcgcca tcggcaagcc ggaatggatt gacgatccgg cctatatgac ggcacaggca       900
     cgtcagccgc acatcttcga tatcttcaac acgatcgaac agtggctcgc tgacaagacg       960
     aagttcgaag ccgtcgatat tctgcgcaag ttcgacattc cgtgttcgcc cgttctgtcg      1020
     atgaaggaaa tcgccaacga tgaatcgctg cgcaagagcg gcacgatcgt cgaagtggac      1080
     cacaaggcac gtggcaagta tctgacggtt ggcagcccga tcaagttctc ggacatgaag      1140
     ccggaaatca cgggttcgcc gctgctcggc gagcacaccg aagaagtgct cgcgggactc      1200
     ggttacagct tcgagcagat cgcgaacatg cgggaagcga aagtggtgta a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page