(data stored in ACNUC29543 zone)

EMBL: CP001044.PE488

CP001044.PE488       Location/Qualifiers
FT   CDS_pept        complement(566700..568439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3618"
FT                   /product="oxalyl-CoA decarboxylase"
FT                   /note="TIGRFAM: oxalyl-CoA decarboxylase; PFAM: thiamine
FT                   pyrophosphate protein domain protein TPP-binding; thiamine
FT                   pyrophosphate protein central region; thiamine
FT                   pyrophosphate protein TPP binding domain protein; KEGG:
FT                   bxe:Bxe_B2759 putative oxalyl-CoA decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3618"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72757"
FT                   /db_xref="GOA:B2JM67"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR017660"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM67"
FT                   /protein_id="ACC72757.1"
FT                   /translation="MADVLEIRPQESAEENAQQMTDGFHLVIDALKANDIDTIFGLVGI
FT                   PITDLARLAQAEGMRFIGFRHEQHAGHAAAIAGYMTQKPGICLTVSAPGFLNGLTALAN
FT                   ATTNCFPMILISGSSEREIVDLQQGDYEEMDQLNAAKPYAKAAYRVLHAEDIGIGLARA
FT                   IRAAVSGRPGGVYLDLPAKLLAQTIDAAKAKQSIVRVIDAAPRQLPAPDSVKRAIDLLK
FT                   SAKRPLVLLGKGASYSQADKEIRAFIEKTGIPYLPMSMAKGLLPDTHEQSASAARSFVL
FT                   AESDVVVLIGARLNWLLAHGKGKTWGKPKQFVQIDISAQEMDSNVAIAAPIVGDIGSCV
FT                   ASLLDQVGDDFPQPPKEWLDAVSQKKNTNLEKMAATLAKNPSPMNFHSALRVLRDIVKE
FT                   NPDINVVNEGANTLDYARAIIDMYQPRKRFDSGTWGVMGIGMGFAIGAAVTSGKQVLAI
FT                   EGDSAFGFSGMELETICRYELPVCTIIFNNNGVYRGTDVNPTGGKDVAPTVFVKDARYD
FT                   KMIEAFGGIGYNVTTPEELEKAVKEAIASGKPTLINAVIDEAAGTESGRLTNLNPQSAA
FT                   MKK"
     atggcagatg tacttgagat cagaccgcaa gaatccgctg aagagaacgc acaacaaatg        60
     accgacggtt tccacctcgt catcgatgcg ctgaaagcga acgatatcga caccattttt       120
     ggtctggtcg gcattcctat taccgacctt gcgcgcctcg cgcaggccga aggaatgcgc       180
     tttatcggtt tccgtcacga gcagcacgca ggtcacgcag ccgccatcgc cggctacatg       240
     acgcaaaagc ccggcatctg tctcacggtg tccgcgccgg gcttcctgaa cggcctcaca       300
     gcgctcgcca acgcgacgac gaactgcttc ccgatgatcc tcatcagcgg atcaagcgaa       360
     cgcgaaatcg tcgacctgca acaaggcgac tacgaagaaa tggatcagct gaacgcagcg       420
     aagccgtatg cgaaggctgc gtatcgcgtg ctgcacgctg aggacatcgg catcggcctc       480
     gcacgcgcca tccgcgctgc cgtgtcgggc cgtccgggcg gtgtgtatct cgacctgccc       540
     gcgaagctgc tggcgcagac catcgacgcc gcgaaggcga agcagtcgat cgtccgtgtg       600
     atcgacgcgg cgccgcgcca gctgcccgcc ccggactccg tcaagcgcgc gatcgatctg       660
     ctgaagagcg cgaagcgtcc gctggtgctg ctcggcaagg gcgcatcgta ttcgcaggcc       720
     gacaaggaaa ttcgcgcatt catcgaaaag acgggcattc cgtatctgcc gatgtcgatg       780
     gccaagggcc tgctgcccga cacgcacgag caatcggctt ccgccgcgcg ttcgttcgtg       840
     ctcgccgaat cggacgtcgt cgtgctgatc ggcgcgcgcc tgaactggtt gctggcgcac       900
     ggcaagggca agacctgggg caagccgaag cagttcgtgc agatcgatat ctcggcgcag       960
     gaaatggaca gcaacgtcgc gattgcggcg cccatcgtcg gcgacatcgg ttcatgcgtc      1020
     gcatcgctgc tcgaccaggt cggcgacgat ttcccgcagc cgccgaagga atggctcgac      1080
     gccgttagcc agaagaagaa cacgaacctg gagaagatgg ccgcgacgct cgcgaagaat      1140
     ccgtcgccga tgaacttcca cagcgcgctg cgcgtgctgc gcgacatcgt caaggagaac      1200
     ccggacatca acgtggtgaa cgaaggcgcg aacacactgg actacgcgcg cgccatcatc      1260
     gacatgtacc agccgcgcaa gcgcttcgac tcgggtacgt ggggcgtgat gggtatcggc      1320
     atgggcttcg cgatcggcgc agccgtgacg agcggcaagc aggtgctcgc gatcgaaggc      1380
     gatagcgcgt tcggcttcag cggcatggaa ctcgaaacga tctgccgtta cgagctgccc      1440
     gtgtgcacga tcatcttcaa caacaacggc gtatatcgcg gcaccgacgt gaacccgacg      1500
     ggcggcaagg atgtcgcgcc gaccgtgttc gtcaaggacg cgcgctacga caagatgatc      1560
     gaggcattcg gcggtatcgg ctacaacgtg acgacgcctg aagagctcga gaaggccgtc      1620
     aaggaagcca tcgcttccgg aaagccgacg ctcatcaacg cagtgatcga cgaagcggca      1680
     ggcacggaaa gcggacgcct gaccaatctg aatccgcaaa gcgcggcaat gaaaaagtaa      1740
//

If you have problems or comments...

PBIL Back to PBIL home page