(data stored in ACNUC29543 zone)

EMBL: CP001044.PE489

CP001044.PE489       Location/Qualifiers
FT   CDS_pept        complement(568670..569389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3619"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: bxe:Bxe_B2268 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3619"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72758"
FT                   /db_xref="GOA:B2JM68"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM68"
FT                   /protein_id="ACC72758.1"
FT                   /translation="MSTDTQENVRAVPLSLNLTPINATASLRDQAYARLKQAIANTDIY
FT                   HSREEVRLDEKELTEALGVSRTPVREAMTLLEQEGFLRTVPRRGVYILRKTKKEIVEMI
FT                   CMWAALESVAARLATQRASSDDIAKLRAMFDDFHSATPTDHIEEYSEVNIAFHQALVEL
FT                   SGSQIILDTIKNIFMHVRAIRRMTIAQSDRASRSIEDHMRIIEALEARDTEQVETLVRQ
FT                   HSLDLALYVETHCDFLD"
     atgtccaccg acacgcaaga aaatgtccgc gcggtcccgt tgagcctgaa tctcacgccg        60
     atcaacgcga cggcctcgct gcgcgatcag gcgtacgccc ggctcaagca ggcgatcgcg       120
     aacaccgaca tctatcactc gcgtgaagaa gtgcgcctgg atgaaaaaga gctgacggaa       180
     gcactcggcg taagccgcac gcccgtgcgc gaggcgatga cgctactcga gcaggaaggc       240
     tttctgcgca ctgtgccgcg ccgcggcgtc tacatcctgc gaaaaaccaa gaaagagatc       300
     gtcgagatga tctgcatgtg ggccgcgctc gaaagcgtgg ccgcccggct cgcgacccag       360
     cgtgcgtcga gcgacgacat cgccaagctg cgcgccatgt tcgacgactt ccattccgcg       420
     acgccaaccg atcacatcga ggagtacagc gaggtgaaca tcgcgtttca ccaggcgctc       480
     gtcgaactgt ccggttcgca gatcatcctc gacacgatca agaacatttt catgcacgtg       540
     cgcgcgatac gccgcatgac gatcgcgcag agcgaccgcg cgtcgcgttc gatcgaagac       600
     cacatgcgca tcatcgaggc gctcgaagca cgcgacacgg agcaagtcga aacgctcgtg       660
     cgtcagcact cgctcgacct cgcgttatac gtcgaaacgc attgcgattt tttggactga       720
//

If you have problems or comments...

PBIL Back to PBIL home page