(data stored in ACNUC29543 zone)

EMBL: CP001044.PE493

CP001044.PE493       Location/Qualifiers
FT   CDS_pept        complement(573873..574604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3623"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4803 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3623"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72762"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM72"
FT                   /protein_id="ACC72762.1"
FT                   /translation="MIRYSRAFFELQWQFAERVAVISGMPREQALMHYTNFYIRFGLGR
FT                   QFDANHDVWRIYIDGLSNAADPVDWSGRFYLARPDVPPPSLIAAFGCFSYSNAGNDAIR
FT                   LHFANTDSRDCSPLSRERIGERRGELRTLFDHVDYTRQTQPAIKRVLGASWLYNLPAYR
FT                   SLFPSSYIETARELSSRFQNMPLWGQFLDRHGNVRPDMRARFLERLARQTSLHELAQCF
FT                   PWRALAVDASIALFDGFYRAH"
     gtgatcagat atagccgggc gtttttcgaa ctgcaatggc aatttgccga acgcgtcgcc        60
     gttatctcgg gcatgccgcg cgagcaggcg ctaatgcatt acacgaattt ctatatccgt       120
     tttggattgg gccgacaatt cgatgccaac catgacgtgt ggcgaatata tatcgatggc       180
     ttgtccaatg cagcggaccc agtggactgg agtgggcgtt tctatctcgc gcggcccgat       240
     gtgccgccgc cctcactgat tgcggcattc ggctgctttt catactcgaa tgcgggcaat       300
     gatgctattc ggctgcattt cgccaatact gattcgcgtg attgctcgcc gttgagccgc       360
     gagcgtatcg gcgaaaggcg cggtgaattg cgcacgctat tcgatcacgt cgattacacc       420
     cgacaaaccc agccggccat caagcgcgtt ctcggcgcgt cgtggctcta caatctgccc       480
     gcttatcgca gcctttttcc ttccagctat atagaaacgg cgcgcgaact gtcgtcacgc       540
     tttcagaaca tgccgttgtg ggggcaattc ctcgaccggc acggcaacgt gcggccggac       600
     atgagggcgc gatttctgga acggctcgcg aggcagacaa gcctgcatga gctcgcgcag       660
     tgctttccat ggcgcgcgct ggccgttgac gcgtccatcg cgctgttcga cggcttttac       720
     cgcgcgcatt ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page