(data stored in ACNUC29543 zone)

EMBL: CP001044.PE497

CP001044.PE497       Location/Qualifiers
FT   CDS_pept        578491..579207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3627"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B1640 ABC lipoprotein exporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3627"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72766"
FT                   /db_xref="GOA:B2JM76"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM76"
FT                   /protein_id="ACC72766.1"
FT                   /translation="MHVSPTHKPSALECRSLSKTYTATRTVLDRLDVKLAAGEFVAIMG
FT                   DSGVGKSTLLNLIAGLDRADSGDVLIDGTPISTLDDDAATRLRRQKLGFVFQAFHVLPH
FT                   LTLEQNVALPLLLNGLAPQRAHDMLAAVGLAGRNDDLPRQLSGGELQRVAIARALVHRP
FT                   TLILADEPTGNLDPDTAHEVLALLREETKANGAATMMVTHSEAAAAFADRVLILSDGKL
FT                   HAADDPQAHAARPSHE"
     atgcacgtat cgcccacgca caaaccgtca gcattagaat gccgctcgtt gagcaaaacc        60
     tacacagcga ctcgaacggt actggaccgc ctggacgtca agctcgccgc gggcgaattc       120
     gtagccatca tgggcgactc aggcgtcggc aagtcgacgc tattgaacct gatcgcgggc       180
     ctggatcgcg ccgactcggg cgatgtgctg atcgacggca cgccgatctc cacactcgat       240
     gacgatgctg caacgcgcct gcgtcgccag aaactaggct tcgtgtttca agccttccat       300
     gtgctccccc atctgacgct cgaacaaaac gtcgcgctgc cgctgctgct gaacggcctc       360
     gcgccgcagc gcgcccacga catgctcgca gccgtcggtc tcgcagggcg caatgacgat       420
     ctgcctcgcc agctatcggg cggcgaactg caacgggtcg cgatcgcgcg cgcgctcgtg       480
     catcgcccga cgttgattct cgccgacgag ccaaccggca atctcgaccc cgacactgca       540
     cacgaggtgc tcgcgctgct gcgcgaagaa accaaggcga acggcgcggc cacgatgatg       600
     gtgacgcact cggaagccgc cgccgctttc gccgatcgcg tgctcatact cagcgacggc       660
     aagctgcacg ccgcagacga tccgcaagcg cacgcggctc gcccctcgca tgaatga          717
//

If you have problems or comments...

PBIL Back to PBIL home page