(data stored in ACNUC29543 zone)

EMBL: CP001044.PE498

CP001044.PE498       Location/Qualifiers
FT   CDS_pept        579200..581776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3628"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bxe:Bxe_B1641 ABC liporpotein exporter, fused inner
FT                   membrane subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3628"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72767"
FT                   /db_xref="GOA:B2JM77"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM77"
FT                   /protein_id="ACC72767.1"
FT                   /translation="MNDAALNATAPARHGLGTLTRWLLSAEWRSHKGRALIAIATIALG
FT                   VALGYAVQLINSAAFNEFSAAARSLSGQADLQVRGTQPTLDERAYPQLATLAGVALASP
FT                   VLELDVTVPDRTAPLKVLGIDVFRSSRIAPDLTGVPASDTTLDALADDAIFLSPAAQQW
FT                   LGVRSGDRLTLRSGTSDVRLRVAGSIVRARPGQRIAVMDIAAAQWRFGRVGKLSRVDLQ
FT                   LERGVDRERFRRDLQDRLGSRFVVGETRDVESRTDRLSRAYRINMNVLALVALFTGAFL
FT                   VFSTQALGVVRRRAQLAMLRVLGITRAQLLRQILLEGALLGTLGSIAGIALGFALAHAV
FT                   LRFFGSDLGGGYFPGVQPAVRFELLASAIFVALGIGVSLLGTLVPALEAARAHPAPALK
FT                   AGGEEAALGKLSTPWPALVCLALGVGLTQVPPVFDVPVAGYLAVALLLIGGIALMPRVT
FT                   SMLFRALSRAGNGRRRAPVTALALARLANAPGQASIAMGGVLSSFTLIVAMAIMVASFR
FT                   VSVEDWLAHLLSADVYVRVAANGDTGGLNLQQQTQLAATRGIRHAAFARTSQLLLDPSR
FT                   PSIALLAREIDAADPGANLQITGTPLPPSAWREGETPVWASEAMVDLYGYRVGQRLTLP
FT                   IGEHSGVRVVVAGIWRDYVRQTGALQIRLADYRRLTSDTSATEAALTLDPGISAAQAIA
FT                   ALRTLPFANALDFAQPGDIRARTLTIFDRSFAVTYLLEAVAIVIGLFGVAATFSAQTLS
FT                   RSREFGMLRHVGVTRGQILALLATEGGMLTALGIAMGCVLGFAISLILVFVVNPQSFHW
FT                   SMSLHVPWLLLSLLALVMLASSCTTAVAAGRQAVSVDAVRAVREDW"
     atgaatgacg ccgcactcaa tgcaacggcg cccgcgcgcc acggcctggg cacgctcacc        60
     cgctggctgc tctccgccga atggcgcagc cacaaaggcc gggcgctgat cgcgatcgcg       120
     acaatcgcac tcggcgtcgc gctcggctat gcagtgcagt tgatcaacag cgccgccttc       180
     aacgagttct cggcagccgc gcgcagtctg tcgggacagg cagatctgca ggtgcgcggc       240
     acgcagccca cactcgacga acgcgcctat ccgcaactcg cgaccctggc cggggttgca       300
     cttgccagcc ccgtgctgga actcgacgtg accgtgcccg accgcactgc gccgctgaaa       360
     gtcctcggca tcgacgtgtt ccgttcaagc cgcatcgcgc ccgacctgac gggcgtgcca       420
     gccagcgaca cgacgctcga tgcgctagcc gacgacgcga tcttcctctc gcccgccgcg       480
     cagcaatggc tgggcgtgcg cagcggcgat cggctgacct tgcgcagcgg cacctccgac       540
     gtacgcctgc gcgtcgcagg cagcatcgtc agagcgcggc ccggacagcg catcgcggtg       600
     atggatatcg ctgccgcgca atggcgcttt ggccgagtcg gcaaactgtc gcgcgtcgat       660
     ctgcaactcg aacgcggtgt cgatcgcgaa cgcttccggc gcgacttgca ggatcggctc       720
     ggcagtcgct tcgtggtggg cgagacacgc gatgtcgaga gccgcaccga ccggctgtcg       780
     cgcgcctatc ggatcaacat gaacgtgctc gcgctcgtcg cgctgttcac gggcgcgttt       840
     ctcgtgttct cgacgcaggc gctcggcgtg gtgcggcggc gcgcgcaatt ggcaatgctg       900
     cgtgtgctcg gcatcacccg cgcacaactg cttcggcaga tcctgctcga aggcgcgttg       960
     ctcggcacgc tcggttcgat tgcgggcatc gcgctcggat ttgcgctcgc gcatgccgta      1020
     ctgcgctttt tcggcagcga cctgggtggc ggctatttcc ccggcgtcca gccggccgtc      1080
     cgcttcgagc tgctcgccag cgcgatcttc gtcgcgcttg gaatcggcgt gtcgctgctc      1140
     ggcactttgg tgcccgcgct cgaagcggcg cgcgcccatc ctgcgcccgc gctgaaagcg      1200
     gggggcgagg aagccgcgct cggcaagctg tcgacgccgt ggcccgcgct cgtctgcctg      1260
     gcgctcggcg tggggctgac ccaggtgccg cccgtcttcg atgtgcccgt cgcgggttac      1320
     ctcgccgtcg cgctgctgct gatcggcggc attgcattga tgccgcgcgt cacgtcgatg      1380
     ctgtttcgcg cactgagccg cgcaggcaac ggacggcggc gcgcgcctgt gaccgcgctg      1440
     gcgctcgcgc ggctcgcgaa tgcgccgggc caggcatcga ttgcaatggg cggtgtgctg      1500
     tcgagcttta cgctgatcgt cgcgatggcg atcatggtgg cgagctttcg cgtgtccgtc      1560
     gaagactggc tcgcgcatct gctgtccgcc gacgtctacg tgcgcgtcgc ggcgaacggc      1620
     gacacgggcg gcctcaacct gcagcaacag acgcaactcg ccgcgacgcg cggcatacgt      1680
     cacgcagcgt ttgcgcgcac atcgcaactg ctactcgatc cgtcgcgccc gtccatcgcc      1740
     ttgctcgcgc gcgaaatcga tgcggccgat cccggcgcga acttgcagat cacgggcacg      1800
     cccttgccac cctccgcgtg gcgcgaaggc gagacacccg tgtgggcgtc ggaagcgatg      1860
     gtcgatctgt acggctatcg ggtcggtcaa cggctgacgc tgccgatcgg cgaacacagc      1920
     ggcgtacgtg tcgtcgtggc tggcatctgg cgcgattacg ttcggcagac gggcgcactg      1980
     caaatccgtc tcgccgacta tcggcgtctg acgagcgaca ccagcgccac cgaagccgcg      2040
     ctcacgctcg atcccggcat cagcgccgcg caggcaatcg ccgcgttgcg cacgctgccg      2100
     ttcgcgaacg cgctcgactt cgcgcaaccc ggcgacatcc gcgcgcgcac cttgaccatt      2160
     tttgaccgca gctttgccgt cacgtatctg ctggaggccg ttgccatcgt gatcggattg      2220
     ttcggtgtcg ccgccacatt ctcggcgcag acgctgtcgc gctcgcgcga gttcggcatg      2280
     ctgcgccatg tcggcgtgac gcgcggacag attctcgcgc tgctcgcgac ggaaggcggc      2340
     atgctcaccg cgctcggcat cgcgatgggg tgcgtgcttg gctttgcgat cagcctgatc      2400
     ctcgtgttcg tcgtcaatcc gcagtcgttc cactggagca tgtcgctgca cgtgccgtgg      2460
     ctgctgctgt ccttgctcgc gctcgtgatg ctcgcgtcgt cgtgcacgac agccgtggcg      2520
     gcgggccgcc aggccgtttc cgtcgatgcc gtgcgcgcgg tcagggagga ctggtga         2577
//

If you have problems or comments...

PBIL Back to PBIL home page