(data stored in ACNUC29543 zone)

EMBL: CP001044.PE5

CP001044.PE5         Location/Qualifiers
FT   CDS_pept        3387..3707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pnu:Pnuc_1610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3106"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72274"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR48"
FT                   /protein_id="ACC72274.1"
FT                   /translation="MAKHEVQSWYRPPQDEVCPLCGRTIPPEQRDEHHMVPKAEGGRET
FT                   VALHRICHRQLHALFSERELATTYASVDRLLDNEQVRAFVNWVRTKPAGFHERTRSSRR
FT                   KR"
     atggcaaagc acgaagtgca atcgtggtat cggccaccgc aggatgaagt ctgtccgctg        60
     tgcggccgca cgattccgcc ggagcagcgc gacgagcatc atatggtccc gaaggcggaa       120
     ggcggccgtg aaacggttgc gctgcaccgg atctgtcatc ggcagctgca tgcgctcttt       180
     tcggagcgcg agttggccac aacctatgca tcggtcgatc gcctcctcga caacgaacaa       240
     gtcagagctt tcgtgaactg ggtacgcacg aagccggccg ggtttcatga acgcacgcgc       300
     agcagccggc gcaagcggtg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page