(data stored in ACNUC29543 zone)

EMBL: CP001044.PE502

CP001044.PE502       Location/Qualifiers
FT   CDS_pept        complement(585980..586318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3633"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   hha:Hhal_0617 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3633"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72771"
FT                   /db_xref="GOA:B2JM81"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM81"
FT                   /protein_id="ACC72771.1"
FT                   /translation="MEKEVPKMGRHRTPYPAEFRAHMVELVRAGRRPEDLEKEFEPTAQ
FT                   TIYNWVAQADRDAGVRHDGLTTAERQELTKLRRENRQLRMERDILSQAAAWFARETGAV
FT                   PPKGGTDS"
     ttggagaagg aggtgccgaa aatgggcaga catcgtacgc catacccggc agagttccgg        60
     gcgcacatgg tggagctggt aagggccggg cgcagaccgg aagacctgga aaaagagttc       120
     gagccgacgg cgcagaccat ctacaactgg gtcgcgcagg ccgatcgtga tgctggtgtg       180
     cgtcacgacg ggctgaccac ggccgaacgg caggagctga cgaagctgcg tcgtgagaac       240
     cggcagctca ggatggagcg cgatattctc tcgcaggcgg cggcctggtt cgcgcgggag       300
     acgggcgccg tgccgccgaa gggcggtacg gattcatga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page