(data stored in ACNUC29543 zone)

EMBL: CP001044.PE506

CP001044.PE506       Location/Qualifiers
FT   CDS_pept        complement(590837..592384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3639"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A4024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3639"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72775"
FT                   /db_xref="GOA:B2JMI1"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMI1"
FT                   /protein_id="ACC72775.1"
FT                   /translation="MSDITVSNPAESRIGAIETGKRIWANAAAAADWVGGALKGEFGQQ
FT                   QTTGQIVFDATISMFPVLGEGTAARDTIAIMMHMADNRQAVEDRWTWIKLVLCLIAVVP
FT                   IFGGVLKGVGKLVIRAFEKSEDLAKLAEELVLFVNRMCHGNAYEWLRKLDFTTYQGKVI
FT                   DGLTDALDRFSGACQYIVRNMGNVLPSHVVAYLSGMPAKLQPIRNAANRMIPQALRDMN
FT                   NCLARVRAHMVEGTWADISVGSGKITTREAEGQLSTLARDAGKAPHPPASLEDYHHVEG
FT                   WPDLRENSHVRKDRGSGARTYEVIESFSKLKPIEAVTLGPGQYVLARVLDNTERTTKSG
FT                   YKLKGVVSETTKRSKNWLPRMAKNGREWREKWAVKMDWNHNGAYITLDHIPTIEELRAA
FT                   GVPNIPQDWTGLRIWRGEVSSQFDEDLGRWLEGGETQFIIDFDDAYNKVWEEYVKRLPV
FT                   KPTNWTDVNFAPVDRAAVRPLDKDQTLPKTVPQGYTNRAPAVAGRALPGTDAAQPQH"
     atgagtgaca ttacagtaag caatccggca gaaagccgga ttggggcaat cgagacggga        60
     aaacggatat gggccaacgc tgccgctgcg gccgattggg tcggcggcgc gttgaagggg       120
     gagttcggcc agcaacagac caccggccag attgtcttcg atgcaacgat cagcatgttt       180
     ccggtcctgg gcgaaggtac ggcggcacgc gacaccatcg cgatcatgat gcacatggcc       240
     gacaatcgcc aggcggtgga ggaccgatgg acctggatca agctggtact ctgcctgatt       300
     gccgtcgtcc cgatctttgg cggcgtcctg aagggtgtcg gaaagctggt catccgagca       360
     ttcgagaaat ccgaagacct ggcgaagctg gccgaagagc ttgtcctgtt cgtgaaccgc       420
     atgtgccacg gtaacgccta tgaatggctg cgcaagctgg atttcaccac atatcagggc       480
     aaggttatcg acggattgac cgacgcgctg gaccgcttct cgggagcatg ccagtacatc       540
     gtgcgcaaca tggggaacgt actgccttcg catgtcgtcg cgtacctgtc gggcatgcca       600
     gcgaagctcc agccgatccg taacgccgca aaccgcatga ttccccaagc gctgcgagac       660
     atgaacaatt gccttgcccg cgtgcgcgca catatggttg agggcacctg ggcagatatt       720
     tcggtcggat cgggcaagat cacaacacgc gaggccgagg ggcagctatc gacacttgcg       780
     cgcgacgcgg ggaaagcgcc gcatcctcca gcatcgctgg aggactatca ccacgtcgaa       840
     ggttggccgg atttgcgcga aaactcgcac gttcggaaag acagaggatc aggggcgagg       900
     acatatgagg ttatcgaatc gttcagtaag ttgaagccaa ttgaggcggt gacgctgggg       960
     ccaggtcaat acgtcttggc acgcgtactc gacaatacgg aacggaccac gaaatctggc      1020
     tacaagttga agggcgtagt cagcgagacg accaaacgct caaaaaactg gttgccccgc      1080
     atggcgaaaa acggacgtga gtggcgagag aaatgggccg tcaaaatgga ctggaaccac      1140
     aacggcgctt atatcacgct ggaccacatc ccgaccatcg aagaactgcg agccgccggt      1200
     gttccgaaca taccccaaga ctggacgggc ctgcgtatat ggcgcggtga ggtatcgagc      1260
     cagtttgacg aagacctggg gcgatggtta gaaggtggcg agacgcagtt catcattgat      1320
     ttcgatgacg cgtataacaa ggtgtgggag gagtatgtga agcgcttgcc ggtcaagccg      1380
     acgaactgga cagacgtgaa ttttgcgccg gttgaccggg cagcagttcg tccgctggac      1440
     aaggatcaaa ccctgccgaa gaccgtcccg cagggctata cgaaccgcgc gccagcagtt      1500
     gcaggccgcg ccctgccagg caccgacgcc gcacaaccgc aacactga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page