(data stored in ACNUC29543 zone)

EMBL: CP001044.PE509

CP001044.PE509       Location/Qualifiers
FT   CDS_pept        complement(595804..596127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3642"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0131 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3642"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72778"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMI4"
FT                   /protein_id="ACC72778.1"
FT                   /translation="MSVPAVITTVIDVDPDRPRRRISNGALLVHIRAVHTESKGEYGWP
FT                   RVWKKLLAQRIRVSKDRIQRLMKLHGIKARMRLAAQLFGRQREAGEDEEEWRMLALTKP
FT                   VRH"
     gtgtcagtcc cagcggttat cacaaccgta atcgacgttg atcctgatcg gccgcgccga        60
     cgcatcagca acggcgcgtt gctggtccat attcgcgccg tccacaccga atccaaaggc       120
     gagtacggct ggccgcgcgt gtggaaaaag ctgcttgcgc aacgcattcg cgtgagcaag       180
     gatcggattc agcggctgat gaagctgcat ggcatcaagg cgcgcatgcg gctcgctgcg       240
     cagttgttcg ggcggcagcg tgaagctggt gaggacgagg aagaatggcg catgctcgcg       300
     ctcactaagc cggtgcggca ctga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page