(data stored in ACNUC29543 zone)

EMBL: CP001044.PE512

CP001044.PE512       Location/Qualifiers
FT   CDS_pept        complement(599801..600142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3646"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /note="TIGRFAM: cytochrome o ubiquinol oxidase subunit IV;
FT                   PFAM: cytochrome C oxidase subunit IV; KEGG: bte:BTH_I1785
FT                   ubiquinol oxidase, subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3646"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72781"
FT                   /db_xref="GOA:B2JMI7"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMI7"
FT                   /protein_id="ACC72781.1"
FT                   /translation="MAHSNSHALDAEAGHGGIGGYVVGFVLAVVLTAAAFGIVMQGWLP
FT                   AAYAPLVLAALAVVQIVVHLVCFLHMSVSTSGQRWNTLALAYTVLAAMFLVFGTVWVMH
FT                   NVSMNMMSR"
     atggctcact cgaattccca cgcgctcgac gctgaagcag gtcatggcgg tatcggtggc        60
     tatgtggtcg gcttcgtgct ggccgtggtg ttgactgccg cggcgttcgg catcgtgatg       120
     cagggctggc tgccggcagc ttacgctccg ttggtgctag ccgcgctcgc cgtcgtgcag       180
     atcgtcgtgc atctggtgtg cttcctgcac atgagcgtgt cgacatcggg ccaacgatgg       240
     aacacgctcg cgctcgctta cacggtgctg gccgctatgt tcctggtgtt tggaaccgtg       300
     tgggtcatgc acaacgtcag catgaacatg atgtcgcgct ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page