(data stored in ACNUC29543 zone)

EMBL: CP001044.PE514

CP001044.PE514       Location/Qualifiers
FT   CDS_pept        complement(600756..602768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3648"
FT                   /product="cytochrome o ubiquinol oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: bmn:BMA10247_A0226 ubiquinol oxidase, subunit
FT                   I; TIGRFAM: cytochrome o ubiquinol oxidase, subunit I;
FT                   PFAM: cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3648"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72783"
FT                   /db_xref="GOA:B2JMI9"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMI9"
FT                   /protein_id="ACC72783.1"
FT                   /translation="MFGNLTLEAIPFDQPIIMGAGALMGLIVLAVAVLLTRTHKWRWLW
FT                   AEWLTSVDHKRIGVMYIVVAVLMLLRGFADAVMMRLQLALASGGATGYLPPHHYDQIFT
FT                   AHGVIMIFFMAMALMVGLFNIVVPLQIGARDVAFPFLNSLSFWMTAISAILMNISLVIG
FT                   EFAQVGWLAYPPLSELQFSPGVGVDYYIWALELSGVGTLITAINFFVTIIKMRAPGMSL
FT                   MKMPVFTWTALCSNVLIMATFPILTIALALLGLDRYADMHFFTNDAGGNAMLYLNLIWA
FT                   WGHPEVYILVLPAFGIYSEVISTFAKKPLFGYKTMVYASCAIMVLAFLVWAHHFFTMGS
FT                   GADVNAFFGIATMIIAIPTGVKIFNWLFTMYRGRLEFTAPVLWTIGFMVTFTIGGMTGV
FT                   MLAIPGADFVLHNSLFLVAHFHNTIIGGVVFGYLAGVSYWFPKVFGFKLNDRLGKAAFW
FT                   FWFVGFFVAFTPLYVLGFMGATRRLNHYDNPAWQPLMIIAACGAALIAIGVVCQVTQFV
FT                   VSIINRNKPEYRDVTGDPWGGRTLEWSISSPPPVYNFATIPVVEELDAFAHMKETGKGL
FT                   GIQAAYRDIHMPSNTSAGFFIGVFSLAFGFAAVWHIWWLAIVALAAIAATVIGRSFGRD
FT                   DGYYIPSDVVRTIENKGRTPLPQRADVAPALAEVE"
     atgttcggca atctgacttt agaggcgatt ccgttcgatc agccgatcat catgggcgcg        60
     ggcgcgctca tggggctgat cgtgctggcc gtcgccgtgc ttttgacgcg cacgcacaag       120
     tggcgctggc tgtgggccga atggctcacg agcgtcgatc acaagcgaat tggggtgatg       180
     tatatcgtcg tcgccgtgct gatgctgctg cgcggtttcg ccgatgctgt gatgatgcgg       240
     ctgcaactcg cgctcgcgag cggtggcgcg accggctatc tgccgccgca ccactatgat       300
     cagatcttca ccgcgcacgg cgtcatcatg attttcttca tggcgatggc gctgatggtg       360
     ggtctgttca atattgtcgt gccgctgcag atcggcgcac gcgacgtcgc gttcccgttc       420
     ctgaactcgc tgtcgttctg gatgacggca atcagcgcga tcctcatgaa catttcgctg       480
     gtgatcggcg agttcgcgca ggtcggctgg cttgcgtatc cgccgctgtc cgaactgcag       540
     ttcagtccgg gcgtgggcgt cgattactac atctgggcgc tggaactgtc cggtgtcggc       600
     acgctgatta cggcgatcaa ctttttcgtc accatcatca agatgcgcgc gcccggcatg       660
     tcgctgatga agatgcccgt gttcacgtgg acggcgctgt gctcgaacgt gctgatcatg       720
     gcgacgttcc cgatcctgac gatcgcgctg gcgttgctgg gcctcgaccg ttacgccgac       780
     atgcacttct tcacgaacga tgccggcggc aacgcaatgc tgtacctgaa cctgatctgg       840
     gcatggggcc accccgaggt ctacatcctg gttctgcccg cgttcggcat ctactcggaa       900
     gtaatctcga cgttcgcaaa gaagccgctg ttcggctaca aaacgatggt ctacgcatcg       960
     tgcgcgatca tggtgctcgc gttcctcgtg tgggcgcacc acttctttac gatgggctcc      1020
     ggcgctgacg tcaacgcgtt cttcggcatc gcgacgatga tcattgccat tccgacaggc      1080
     gtgaagatct tcaactggct gttcacgatg tatcgcggcc gcctcgagtt cacggcgccc      1140
     gtgctatgga cgatcggctt catggtcacg ttcacgatcg gcggcatgac gggcgtgatg      1200
     ctggcgattc cgggcgcgga cttcgtgctg cacaattcgc tgttcctcgt tgcgcacttc      1260
     cataacacga ttatcggcgg cgtggtgttc ggctatctgg cgggcgtcag ctactggttc      1320
     ccgaaggtgt tcggtttcaa gctgaacgac aggctcggca aggctgcgtt ctggttctgg      1380
     ttcgttggct tcttcgtggc gttcacgccg ctctacgtgc tcggcttcat gggtgcgacg      1440
     cgccgtctga accactacga caatcccgca tggcagccgc tcatgatcat cgctgcatgc      1500
     ggtgcggcgc tcatcgcgat cggcgtggtg tgccaggtga ctcagttcgt ggtcagcatc      1560
     atcaaccgca acaagccgga gtatcgcgac gtaacgggcg atccgtgggg cggccgcacc      1620
     ttggaatggt cgatttcgtc gccgccgccc gtctataact tcgcgacgat tcctgtcgtc      1680
     gaagaactcg atgccttcgc gcatatgaag gagaccggca agggtctcgg tattcaggct      1740
     gcctatcggg acatccacat gccgtcgaac acgtccgccg gcttctttat cggtgtgttc      1800
     agtcttgcct ttggcttcgc tgctgtctgg cacatctggt ggctggcgat tgtcgcgctg      1860
     gccgcgattg cggcgaccgt gatcggccgc agcttcggtc gcgatgacgg ctactacatt      1920
     ccgtccgacg tggtacggac gatcgaaaac aaaggccgca cgccgcttcc gcaacgcgcg      1980
     gacgtggcgc cggcgctcgc ggaggtcgag tga                                   2013
//

If you have problems or comments...

PBIL Back to PBIL home page