(data stored in ACNUC29543 zone)

EMBL: CP001044.PE515

CP001044.PE515       Location/Qualifiers
FT   CDS_pept        complement(602772..603671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3649"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /note="TIGRFAM: ubiquinol oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; COX aromatic rich domain
FT                   protein; KEGG: bvi:Bcep1808_2823 ubiquinol oxidase, subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3649"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72784"
FT                   /db_xref="GOA:B2JMJ0"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMJ0"
FT                   /protein_id="ACC72784.1"
FT                   /translation="MLARKTLRGCLVPVSAGLTACLAGCQLEVLDPKGSVGVAEKSLIA
FT                   TATWTMLIVVIPVILLTLLFAWRYRASNKSAVYAPKWAHSTAIELIVWTIPALIILFLG
FT                   ILTWRTTHELDPYKPLESSVKPIDVEVVALDWKWLFIYPDLGIASVNQLAMPVGTPVNF
FT                   HITSDSVMNSFFIPQLGTQVYAMAGMQTRVHLVADEPGDYAGVSANFSGKGFSDMKFRT
FT                   LAVSQADFNSWVQKVKASAERLDMDGYYAVAKPSEKNPVRYFSSVDPKLFHNVIAKYNS
FT                   GHVVDFRDANCATNASKE"
     atgttagcca gaaaaacctt aagaggttgc ctcgtacccg tcagcgccgg tctgacggcg        60
     tgtcttgcgg gatgtcaact tgaagtgctc gacccgaaag gcagtgtcgg cgtcgccgaa       120
     aaatcgctga tcgcgacggc aacgtggacg atgctgatcg tcgtcatacc cgtcattctg       180
     ttgacgctgc ttttcgcgtg gcggtatcgc gcgtcgaaca aaagcgcggt ctacgcgccg       240
     aagtgggcac actccaccgc aatcgaattg attgtgtgga cgatccccgc gctgatcatc       300
     ttgttcctcg gcattctgac gtggcgcacc acgcacgaac tggatccgta caagccgctc       360
     gaatcgagcg tgaagcccat cgacgtcgaa gtcgtcgcgc tcgactggaa gtggctcttc       420
     atctatcccg atctcggcat tgcgtcggtg aatcagctgg cgatgcccgt cggcacgcct       480
     gtcaatttcc atatcacgtc tgactcggtg atgaattcat tcttcatccc gcaactgggc       540
     acgcaggtgt acgcgatggc gggcatgcag acgcgtgtcc atctggtcgc agacgaaccc       600
     ggcgactacg cgggtgtgtc ggcgaatttc agcggcaagg gcttctctga catgaagttc       660
     cgcacgctcg ccgtcagcca ggctgatttc aacagctggg tgcagaaggt caaggcatcg       720
     gcggagcggc tcgacatgga cgggtactac gccgtcgcca aaccgagcga aaagaacccg       780
     gtgcgctatt tctcgtcggt ggatccaaag ctgttccaca acgtgattgc gaaatacaac       840
     agtgggcatg tcgtcgattt ccgtgacgcc aattgcgcca cgaacgcttc gaaggagtaa       900
//

If you have problems or comments...

PBIL Back to PBIL home page