(data stored in ACNUC29543 zone)

EMBL: CP001044.PE520

CP001044.PE520       Location/Qualifiers
FT   CDS_pept        complement(606479..607678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3654"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bxe:Bxe_A0821 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3654"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72789"
FT                   /db_xref="GOA:B2JMJ5"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMJ5"
FT                   /protein_id="ACC72789.1"
FT                   /translation="MNNLAKLTLVGISLTSLTLMGCGRKEQPSQHATQDEAGSAEEVVK
FT                   IGHVGPLTGGSSHLGKDNENGARLAVEDINKTGLVIGGRKVRLELDGEDDAADPKTGTQ
FT                   IAQKFVDEHVVAVIGHLNSGVSIPASRIYNEANIAEISPSSTNPDYTKQGYRSAYRVVA
FT                   TDAQQGPALGGYALRSLGAKTIAVVDDATAYGKGLADEFAKAAQAGGARIVAREATTDK
FT                   ATDFRAILTAIKSAHPDVIMFGGMDSTVGPFIRQAAALGLNTRVLSGDGACTEKVAELA
FT                   GDSVNILVCSEASLAVSRMPKGAEFQKRFEARFNGPILFNAPFAYDAVYVIADAMRRAN
FT                   TTDAAKVLAALPATDYNGVIGHIAFDAHGDMKAGAITLYHYQDKKKTLLDVVKYGNAST
FT                   "
     ttgaataacc tggcaaaact gaccttggtc ggtatttcgc tgactagcct gacgctgatg        60
     ggctgcggca ggaaagagca accttcgcag cacgcaacgc aagatgaagc cggttcagcc       120
     gaagaagtgg tgaagatcgg acacgtcggg ccactgacgg gcggcagtag tcatttgggc       180
     aaagacaacg agaacggggc acgtcttgcc gtcgaagaca tcaacaagac aggtctggtg       240
     atcggcgggc gtaaggtgcg gctcgaactg gacggtgagg acgatgcggc ggatccgaag       300
     acgggcacgc agatcgcgca aaagttcgtc gacgagcatg tggttgccgt catcggccac       360
     ctgaactccg gtgtgtcgat tccagcgtcg cgcatctaca acgaggcgaa tatcgcggag       420
     atttcaccgt cttccaccaa tccagactat acgaagcagg gctacaggag cgcgtaccgc       480
     gtagtcgcga cggacgcgca acaggggccc gcgctcgggg gctatgcgct gagatcgttg       540
     ggtgcgaaga cgattgccgt cgtcgacgat gcgacggcct acggcaaggg gcttgccgac       600
     gagttcgcga aggccgcgca ggcgggcggc gcgcgcatcg tcgcgcgcga ggcaaccacc       660
     gacaaggcca ccgatttccg cgccattctc accgccatca agagcgcgca tcccgacgtg       720
     atcatgttcg gcggcatgga ttcgacggtt ggaccattca ttcggcaagc ggctgcgctt       780
     ggcttgaata cgagggtcct gagcggcgat ggcgcatgca ccgagaaagt ggccgagctt       840
     gctggcgact cggtgaacat cctggtatgt tccgaagcga gtcttgctgt ttcccgcatg       900
     ccgaagggcg cggagttcca gaagcgcttc gaggctcgct tcaatggccc cattttgttc       960
     aacgccccgt tcgcgtacga cgcggtttat gtgatcgccg atgcgatgag gcgagccaac      1020
     acgacggacg ccgcgaaggt cctcgcggcg ttgcccgcca ccgattacaa cggcgtgatc      1080
     ggccatatcg cattcgatgc acacggcgac atgaaggcag gcgcgatcac gctgtatcac      1140
     taccaggaca aaaagaagac gctgcttgat gtcgtgaagt acggcaacgc ttccacctga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page