(data stored in ACNUC29543 zone)

EMBL: CP001044.PE523

CP001044.PE523       Location/Qualifiers
FT   CDS_pept        complement(610100..610663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3657"
FT                   /product="peroxiredoxin"
FT                   /note="TIGRFAM: peroxiredoxin; PFAM: alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen;
FT                   Redoxin domain protein; KEGG: bte:BTH_II1926 alkyl
FT                   hydroperoxide reductase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3657"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72792"
FT                   /db_xref="GOA:B2JMJ8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMJ8"
FT                   /protein_id="ACC72792.1"
FT                   /translation="MPIINSQVKPFKATAFHNGDFVTVTDETLKGKWSVVVFYPADFTF
FT                   VCPTELGDLADRYEEFKKLGVEIYSVSTDTHFTHKAWHDTSDTIQKIKYPMVADPTLAI
FT                   SRNFDVLIEEEGLALRGTFVINPEGEIKLCEIHDNGIGRDAGELLRKVQAAQYIAAHPG
FT                   EVCPAKWTPGAETLSPSLDLIGKI"
     atgccgatca tcaacagcca ggtcaaaccg ttcaaggcaa ccgcattcca caatggcgat        60
     ttcgtgaccg tcaccgacga gaccctcaag ggcaagtggt ccgtcgtcgt gttctatccg       120
     gccgacttta cgttcgtgtg cccgacggaa ctgggcgatc tggccgaccg ttacgaagag       180
     ttcaagaagc tcggcgttga aatctacagc gtgtcgacgg atacgcattt cacgcacaag       240
     gcatggcacg acacgtcgga cacgatccag aagatcaagt acccgatggt tgccgatccg       300
     acgcttgcga tctcgcgcaa cttcgacgtg ctgatcgaag aagaaggcct ggcgctgcgc       360
     ggcacgttcg tgatcaatcc ggaaggcgag atcaagctgt gcgaaatcca cgacaacggc       420
     atcggccgtg acgctggcga gctgctgcgc aaggtgcagg ctgcgcaata catcgctgcg       480
     catccgggtg aagtctgccc cgccaagtgg acgccgggcg ctgaaacgct gagcccgtcg       540
     ctcgacctga tcggcaagat ctaa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page