(data stored in ACNUC29543 zone)

EMBL: CP001044.PE526

CP001044.PE526       Location/Qualifiers
FT   CDS_pept        complement(614498..614689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3660"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72795"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMK1"
FT                   /protein_id="ACC72795.1"
FT                   /translation="MDYRVTYEHSLATAPDDYIVNVPSQLVSDVPPNIPKALLPEVIEK
FT                   LILERSPRIGRIRNLRLI"
     atggactacc gcgttaccta cgagcacagc ctcgccaccg cgccggacga ctacattgtg        60
     aatgtgccgt cgcaactggt gtcggatgtg ccgccgaaca ttcccaaggc gctgctgccc       120
     gaagtcatcg agaaactgat tctcgagcgt tcgccgcgca tcggccgcat ccgcaatctg       180
     agactcatct ga                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page