(data stored in ACNUC29543 zone)

EMBL: CP001044.PE527

CP001044.PE527       Location/Qualifiers
FT   CDS_pept        complement(614916..615107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3661"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_3637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3661"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72796"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMK2"
FT                   /protein_id="ACC72796.1"
FT                   /translation="MKKLLTLAAVALVTIGLAGCVVAPPYGYGYAPAYGYAPGYYAGPS
FT                   VSVGVGYSCCWGHGGWHR"
     atgaaaaaac ttctgacgct ggcagccgtc gccctggtga caatcggttt agcgggctgc        60
     gtcgtcgcgc caccatatgg atacgggtac gcgccggcct acggctatgc gccgggttat       120
     tacgcgggcc cttcagtgag cgtcggcgtc ggttacagct gttgctgggg gcatggcggc       180
     tggcatcgat ga                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page