(data stored in ACNUC29543 zone)
EMBL: CP001044.PE527
CP001044.PE527 Location/Qualifiers
FT CDS_pept complement(614916..615107)
FT /codon_start=1
FT /transl_table=11
FT /locus_tag="Bphy_3661"
FT /product="hypothetical protein"
FT /note="KEGG: bvi:Bcep1808_3637 hypothetical protein"
FT /db_xref="EnsemblGenomes-Gn:Bphy_3661"
FT /db_xref="EnsemblGenomes-Tr:ACC72796"
FT /db_xref="UniProtKB/TrEMBL:B2JMK2"
FT /protein_id="ACC72796.1"
FT /translation="MKKLLTLAAVALVTIGLAGCVVAPPYGYGYAPAYGYAPGYYAGPS
FT VSVGVGYSCCWGHGGWHR"
atgaaaaaac ttctgacgct ggcagccgtc gccctggtga caatcggttt agcgggctgc 60
gtcgtcgcgc caccatatgg atacgggtac gcgccggcct acggctatgc gccgggttat 120
tacgcgggcc cttcagtgag cgtcggcgtc ggttacagct gttgctgggg gcatggcggc 180
tggcatcgat ga 192
//
If you have problems or comments...
Back to PBIL home page