(data stored in ACNUC29543 zone)

EMBL: CP001044.PE528

CP001044.PE528       Location/Qualifiers
FT   CDS_pept        615445..615729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3662"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3662"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72797"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMK3"
FT                   /protein_id="ACC72797.1"
FT                   /translation="MSSRHDRSDPSEPNACDAQDWSSPRAYPEADLMRGLQLASDTVLR
FT                   LATQTHAAVARGDPASAEAARESLEKQLALTTRLIDELLFDGEVRHTTH"
     atgtcttccc gtcatgacag aagcgatcca tccgagccga acgcctgcga cgcacaggat        60
     tggagcagtc cgcgggcgta cccggaggcc gatctgatgc gcggcctgca gctcgcgtcc       120
     gacacggtgt tgcgcctcgc cacccagacg catgccgccg tggcgcgtgg cgacccggcg       180
     agtgccgaag cggcgcgcga gtcgctggaa aagcagctcg cgctgaccac ccggctgatc       240
     gacgagcttc tgttcgatgg tgaagttcgt cacaccaccc attga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page