(data stored in ACNUC29543 zone)

EMBL: CP001044.PE536

CP001044.PE536       Location/Qualifiers
FT   CDS_pept        621614..622189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3670"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3670"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72805"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:B2JML1"
FT                   /protein_id="ACC72805.1"
FT                   /translation="MIRLPSAFIVCASTASLLVLASTANAQTTQPAQQASATKPAEAVR
FT                   LHAADQTFINEGTRAVATQRDAARIATSRSTDREVKAFAEKVAADNLQIADSLRAASPR
FT                   GVDVPHNNPDTAVLDSIKTMRGAEFDKTYIEQIALADGQKTLSAFQAEIASGRNEQLKD
FT                   AARKALPVIQAQYASAQDLAKRKHLAAK"
     atgatccgtt tgcccagcgc tttcatcgtt tgtgcatcca cggccagcct gctggtgctc        60
     gcatcgacgg cgaacgcgca gaccacgcaa ccggcacaac aggcatccgc cacgaagccc       120
     gcagaggccg tacgcttgca cgcagccgac cagaccttca tcaacgaagg cacgcgagcc       180
     gtcgccacgc aacgcgatgc tgcacgcatt gcgacatccc gttcgacgga tcgtgaagta       240
     aaggcattcg ccgaaaaggt cgccgccgac aatctccaga tcgccgactc gctgcgcgca       300
     gcgagcccgc gcggcgtcga cgtgccgcac aacaacccgg acacggcggt actcgacagc       360
     atcaaaacga tgcgcggcgc ggaattcgac aagacgtaca tcgagcagat cgcactggcc       420
     gacggacaga aaacgctgtc ggcgtttcag gcggaaatcg cgtcgggccg caacgagcag       480
     ttgaaggacg ccgcgcgcaa ggcgctgcct gtcatccagg cgcaatacgc gtcagcgcaa       540
     gaccttgcaa agcgcaagca tctcgcagcg aagtaa                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page