(data stored in ACNUC29543 zone)

EMBL: CP001044.PE539

CP001044.PE539       Location/Qualifiers
FT   CDS_pept        623497..623991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3673"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   rso:RSc2896 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3673"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72808"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B2JML4"
FT                   /protein_id="ACC72808.1"
FT                   /translation="MSLDRLLAGPRSRRCVAHTLGALTLSLAALTSATARADDCFEQAA
FT                   VYQGVNPLILRAVAWHESKGDPAAVNRNSNGSVDVGQAQINSVHFSDLKRLGIPHRALT
FT                   DACVNIYVAAWLIKQKMVKYGNTWRAIGAYHSESPKERDAYARSIQKILVAWGELLPAA
FT                   R"
     gtgtctcttg atcgattgct cgctgggccg cgctcacggc gctgcgtcgc acatacgctc        60
     ggtgcgctga ccctgtcgct cgccgccctg acgagcgcga cggctcgcgc cgatgactgc       120
     ttcgagcagg ccgccgtcta ccagggcgtc aatccgctga tcctgcgtgc ggtcgcctgg       180
     cacgaatcga agggcgatcc ggccgccgtc aaccgcaatt cgaacggctc ggtcgacgtc       240
     ggccaggcgc agatcaattc cgtgcacttc agtgacctga aacgccttgg cattcctcat       300
     cgcgcgctta cggatgcatg cgtgaacatc tacgtcgccg catggctcat caaacagaag       360
     atggtgaaat acggcaacac gtggcgcgcg atcggcgctt accactcgga gtcgccgaaa       420
     gagcgcgacg cctatgcgcg cagcatccag aagattctcg tcgcgtgggg cgaactgctg       480
     ccggcggcgc gctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page