(data stored in ACNUC29543 zone)

EMBL: CP001044.PE541

CP001044.PE541       Location/Qualifiers
FT   CDS_pept        625063..625455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3675"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72810"
FT                   /db_xref="UniProtKB/TrEMBL:B2JML6"
FT                   /protein_id="ACC72810.1"
FT                   /translation="MEVERVERIVVALRRAAEHERLVSYQRFHAMFGASDPLTARYDAL
FT                   ERAIASLGEVSNIDYGVLLALSNGLPGPDFFRRYQKHRYADYVAVMGPPIHRQSIKRKR
FT                   LLVEAERRRVYEDARRKASCHAAETA"
     atggaagtcg aacgggtgga gcgtatcgtc gtggcgttgc ggcgcgcggc agaacatgag        60
     cgtcttgtga gctatcagcg gtttcatgcg atgttcggcg cgagcgatcc cctcacggct       120
     cgctacgacg cgctggagcg cgccatcgct tctctcggcg aagtgtcgaa tatcgattac       180
     ggcgtgctgc tcgcgctcag caacggcttg cccggccccg acttcttccg ccgctatcag       240
     aagcaccgct acgccgacta cgtcgccgtc atggggccgc ccatccatcg gcaatcgatc       300
     aagcgcaagc gcctgctggt cgaagcggaa cgccgtcgcg tctatgagga tgccagaaga       360
     aaggcgtcct gccacgccgc cgaaaccgcc tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page