EMBL: CP001044.PE546

CP001044.PE546       Location/Qualifiers
FT   CDS_pept        complement(627956..628291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3680"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   bte:BTH_I2656 domain of unknown function, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3680"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72815"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JMM1"
FT                   /protein_id="ACC72815.1"
FT                   /translation="MIERHMVSTTFDLPGHTVDASLGMVRGIIVRSRSVVGSIGAGLQT
FT                   IFGGNISLYTSLCERARQDAYERMLADAAMLGANAVIGMRYDATEIGAGVTEVLCYGTA
FT                   VHARRNV"
     atgattgaac gacacatggt ctccaccacc ttcgatttgc ctggccacac cgtcgacgcg        60
     tcgctcggca tggtacgcgg catcatcgtg cgctctcgtt ccgtggtggg atcgattggc       120
     gcggggctgc aaaccatctt cggcggcaac atctcgctgt acacctcgtt gtgcgagcgt       180
     gcacggcagg acgcgtatga gcgcatgctg gccgacgcgg cgatgctcgg cgccaatgct       240
     gtcatcggca tgcgctacga tgcgaccgag atcggcgcgg gcgtgacgga agtgctctgc       300
     tatggaacgg ccgtgcacgc gcgccgcaac gtataa                                 336
//