(data stored in ACNUC29543 zone)

EMBL: CP001044.PE548

CP001044.PE548       Location/Qualifiers
FT   CDS_pept        complement(629166..629456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3682"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72817"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMM3"
FT                   /protein_id="ACC72817.1"
FT                   /translation="MYLCKTQLLAGHCRDGRADSPTGRSAFMRRAVWRGRLRADVCVSE
FT                   QDTSPMQTGIAEARLQTAAAGAVPFVAYVGAGFRYSRVRALEPSPLACAMR"
     gtgtacctgt gcaagacgca gttgctggcc ggtcattgta gagacggacg tgcggattcg        60
     ccaaccgggc ggtcggcgtt catgcggcgg gcagtctggc gtggccggct tcgtgcggat       120
     gtctgcgtat cggagcagga tacgtcgccc atgcagaccg ggatcgccga agcgcgactt       180
     caaaccgccg ctgcgggcgc ggttccgttc gtcgcgtatg tcggcgctgg ttttcgatat       240
     tcgcgcgtta gggcgctgga gccttcgccg ttggcttgcg cgatgcgatg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page