(data stored in ACNUC29543 zone)

EMBL: CP001044.PE549

CP001044.PE549       Location/Qualifiers
FT   CDS_pept        629458..630612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3683"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: pap:PSPA7_3642
FT                   probable acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3683"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72818"
FT                   /db_xref="GOA:B2JMM4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMM4"
FT                   /protein_id="ACC72818.1"
FT                   /translation="MIRDQETLSILLDSLSRFVRERLVPAENEVAETDEIPADIVGDMR
FT                   ELGLFGLSIPEEYGGLGLTMEEEVLAAFEIAKASPAFRSLIGTNNGIGSQGLVIDGTDE
FT                   QKQYYLPKLASGELIASFALTEPGSGSDAASLRTTALRDGDHYVINGTKRFITNAPEAG
FT                   IYTVMARTSPDSKGAGGISAFIVEKGTPGLSLGKIDKKMGQKGAHTCDVIFENCRVPAS
FT                   NMIGGKEGVGFKTAMKVLDKGRLHISAICVGAAERMLDDALRYAMERKQFGQPIAEFQL
FT                   VQAMLADSRAEIYAARSMVLDAARRRDEKHDVSTEASCCKLFASEMCGRVADRAVQIHG
FT                   GAGYVSDYAVERFYRDVRLFRIYEGTTQIQQLVIARNMIRDASR"
     atgatccgcg atcaggaaac actgtccatt cttctcgatt cgttatcgcg cttcgtgcgc        60
     gagcgtctcg tgcccgccga aaacgaagtc gccgaaacgg atgaaatccc tgccgatatc       120
     gtcggcgaca tgcgcgaact cggactcttc ggcctgtcga ttcccgagga atacggcggc       180
     ctcggtctga cgatggaaga ggaagtgctc gccgcgttcg agatcgcgaa agcttcgccc       240
     gcattccggt cgctgatcgg cacgaataac ggcatcggtt cgcaaggact cgtcatcgac       300
     ggcacggacg agcagaagca atactatctg ccgaagctcg catcgggtga gctgatcgcg       360
     tcgttcgcac tgacggagcc gggttcgggc tcggacgccg cttcgctgcg cacgaccgcc       420
     ctgcgcgatg gtgaccatta cgtgatcaat ggcaccaagc gtttcattac caatgcaccc       480
     gaagccggca tctatacggt gatggcgcgc accagcccgg acagcaaggg tgcgggcggc       540
     atctctgcgt tcatcgtcga aaaaggcacg ccaggcctgt cgctgggcaa gatcgacaag       600
     aagatgggcc agaaaggcgc gcacacctgc gacgtgatct tcgagaactg ccgcgtgcct       660
     gcgtcgaaca tgatcggtgg caaggaaggc gtcggcttca agacggccat gaaagtcctc       720
     gacaagggcc gcctgcatat ctccgcgatc tgcgtcggcg cggccgagcg catgctcgat       780
     gacgcgctgc gctatgcaat ggagcgcaag cagttcggcc agcccattgc cgagtttcag       840
     ctggtgcagg cgatgctcgc tgacagccgc gcggaaatct acgccgcgcg ttcgatggtg       900
     ctcgacgccg cgcgccgccg cgacgagaaa cacgacgtat cgacggaagc atcgtgctgc       960
     aagctgttcg cgtcggagat gtgcgggcgc gtcgccgatc gcgcggtgca gattcatggc      1020
     ggcgcaggat atgtgtccga ctatgccgtc gaacgcttct atcgcgacgt gcgcctgttc      1080
     cgcatttacg aaggcacgac gcagatccag caactggtga tcgcacgcaa catgattcgc      1140
     gacgcaagcc gctaa                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page