(data stored in ACNUC29543 zone)

EMBL: CP001044.PE552

CP001044.PE552       Location/Qualifiers
FT   CDS_pept        634333..635514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3686"
FT                   /product="acetate kinase"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: bvi:Bcep1808_6166 acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3686"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72821"
FT                   /db_xref="GOA:B2JMM7"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMM7"
FT                   /protein_id="ACC72821.1"
FT                   /translation="MDVILVINAGSSSIKFHAFHAQGAQLEPIAGGKLEEIYTNPRFTA
FT                   KRQNGEVIEDKRWPEGEQLGHDNAIAFLLDWLRSHGEGRATLLAVGHRVVHGGDKYAEP
FT                   VRVDAKVMEELEALVPLAPLHQPHNLAAIRSIMARNTNVPQIACFDTAFHHTQPAVATR
FT                   FALPPDITSRGVRRYGFHGLSYEYIASVLPQVDERAAKGKTVVMHLGNGASMAAFDGCK
FT                   SIASTMGFTAVEGLVMGTRSGSLDPGVVLWMLEEANMDARAIESLLYKRSGLLGVSGIS
FT                   SDMRTLLASDDPKAAEAVELFCYRISRELGSLAAALGGLDAIVFTAGIGERADAVRKRV
FT                   GQLAAWLGVSLDEAANQRHGPCISDAKSAVDVWVIPTNEELMIARHALSRLES"
     atggacgtca ttctcgtcat caacgcgggt tcgtctagca tcaagtttca tgcgttccac        60
     gcacagggtg cgcaactcga acccatcgca ggcggcaagc tcgaagagat ttatacgaac       120
     ccgcgcttca cggcgaagcg gcaaaacggc gaggtcatcg aagacaagcg ctggcccgaa       180
     ggcgagcaac tcggacatga caacgcgatc gcgtttctgc tcgactggct gcgcagtcac       240
     ggcgagggcc gtgcgacgct gctcgcggtc ggccaccgcg tcgtgcatgg aggcgacaag       300
     tacgccgagc cggtgcgcgt cgatgcgaag gtgatggaag aactcgaagc gctcgtgccg       360
     ctcgcgccgc tgcatcaacc gcacaatctc gcggccatcc gctcgatcat ggcgcgcaac       420
     acgaacgtgc cgcagatcgc gtgcttcgat accgcgttcc atcacacgca gcccgccgtc       480
     gcgacgcgct tcgcgctgcc gcccgacatc acgagccgcg gcgtgcggcg ttacggcttt       540
     catgggctgt cgtacgaata catcgcaagc gtgctgccgc aagtcgacga acgcgcggcc       600
     aaaggcaaga ccgtcgtgat gcatctgggc aacggcgcga gcatggcggc cttcgatggc       660
     tgcaagagca tcgcgagcac gatgggcttc acggccgtcg aagggctcgt gatgggcacg       720
     cgctcgggca gtctcgatcc tggcgtcgtg ttgtggatgc tcgaagaagc gaacatggac       780
     gcacgcgcga tcgaatcgct gctctataag cgctcgggcc tgctcggcgt atcgggcatt       840
     tccagcgaca tgcgcacgct gcttgccagc gacgacccga aagccgccga agccgtcgag       900
     ctgttctgct accgcatctc gcgcgaactc ggctcgctcg cggccgcact cggcggcctc       960
     gatgcgatcg ttttcaccgc gggcatcggc gaacgcgcgg acgcggtgcg caagcgcgtc      1020
     ggccagctgg ccgcgtggct cggcgtatcg ctcgacgaag cggcaaacca gcgccacggt      1080
     ccgtgcatca gcgatgcgaa aagcgcggtc gacgtatggg tcattccgac caacgaagaa      1140
     ctgatgatcg cccggcacgc actcagccgg ctggagagct ag                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page