(data stored in ACNUC29543 zone)

EMBL: CP001044.PE557

CP001044.PE557       Location/Qualifiers
FT   CDS_pept        complement(639421..639861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3691"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3691"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72826"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMN2"
FT                   /protein_id="ACC72826.1"
FT                   /translation="MKAKWAAVLIAASTFGVMSSQASAQVAGSQTIGVSVEQEAIIING
FT                   WSAKKSLLGKPIYNEQGQKVGVLHDIIIAPDNAASFAIVAAHQFLGVSQHDVAVPLSQI
FT                   DYSNGKLVWAGATKDAVKAIPAFQYAKVRATPMARKEYSEHH"
     atgaaagcaa aatgggcagc ggttttgatc gcggcatcga cgttcggcgt gatgtccagt        60
     caggcaagcg cgcaggtggc gggctcgcag accatcggcg tgagcgtgga gcaggaagcg       120
     atcatcatca atggctggag cgcgaagaag agcctgctcg gcaagccgat ctacaacgag       180
     cagggccaga aggtcggcgt gctccatgac atcatcattg cgccggacaa cgcagcgtcg       240
     ttcgcaatcg tcgccgcgca tcagttcctc ggcgtgtcgc agcatgacgt cgccgtcccg       300
     ctgtcgcaaa tcgactattc gaacggcaag ctggtctggg cgggcgcgac aaaggatgcc       360
     gtgaaggcga tcccggcatt ccagtatgcg aaggtccgcg caacgccgat ggctcgcaag       420
     gaatacagcg agcatcactg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page