(data stored in ACNUC29543 zone)

EMBL: CP001044.PE558

CP001044.PE558       Location/Qualifiers
FT   CDS_pept        complement(640008..640859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3692"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_3952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3692"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72827"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMN3"
FT                   /protein_id="ACC72827.1"
FT                   /translation="MQVLNPVLASANRVLSAVGVALCVALASSGGTVVYAASTAAHKAS
FT                   EPKASNETQGAQQTQQASAASTPDRFTADDPVKVRDMFASQISTGETHSLTERIRKLAR
FT                   EPYDRFVHGRAATAGNAQRTFLFMIPAPHGILYRSSTHMLSVNVPLASDDDPDVIQLYQ
FT                   SIEGPRGRGLVIAPDAKAKGFIQKIDSIELATAGKKTTARGRLKLPQASFEQADDNFAI
FT                   VLVCTLEPPYLTETREHSDPTDEEPTDITRRTSTLHANVQAVWLVNKKDNTVLAKGLHL
FT                   AK"
     gtgcaagttc tgaatcctgt gcttgcttcg gcaaatcgcg tgctgtctgc tgtgggtgtc        60
     gcgctttgtg ttgcgctggc gtcgagcggc ggtacggtgg tctatgctgc atcgactgcc       120
     gcgcacaagg ctagcgagcc gaaagcgtcg aacgaaacgc aaggcgcgca acagacacag       180
     caagcgagcg ccgcgtccac gcccgaccgc tttacggccg acgatcccgt caaggtgcgc       240
     gacatgttcg cgagccagat ctccacgggc gagacacatt cgctcaccga gcgcatccgc       300
     aagctggcgc gcgagccata cgatcgcttc gtgcatggtc gtgcggcgac ggcggggaac       360
     gcgcagcgca cgttcctgtt catgattccc gcgccgcacg gcatcctgta ccggtcgagc       420
     acgcatatgc tgagcgtcaa cgtgccgctt gcaagcgacg acgatcccga cgtcatccag       480
     ctttatcaga gcatcgaggg cccgcgcgga cgcggtctcg tgatcgcacc cgatgcgaag       540
     gccaagggct ttatccagaa aatcgattcg atcgaactgg cgacggcagg caagaagacg       600
     acagcgcgcg gccgtctgaa gctgccgcaa gccagcttcg agcaggccga cgacaacttt       660
     gcaatcgtgc tcgtgtgcac gctcgaacca ccgtatctga cggagacgcg tgagcacagc       720
     gatcccaccg acgaagagcc caccgatatc actcgccgca cctcgacgct gcatgccaac       780
     gttcaggccg tctggctcgt gaacaagaag gacaacacgg tgctcgcaaa aggattgcac       840
     ctcgcgaagt ag                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page