(data stored in ACNUC29543 zone)

EMBL: CP001044.PE56

CP001044.PE56        Location/Qualifiers
FT   CDS_pept        64552..65856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3157"
FT                   /product="CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; CobB/CobQ
FT                   domain protein glutamine amidotransferase; KEGG:
FT                   bxe:Bxe_B1656 CobB"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3157"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72325"
FT                   /db_xref="GOA:B2JRJ8"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRJ8"
FT                   /protein_id="ACC72325.1"
FT                   /translation="MPACPALFISAPASGQGKTTVTAALARHHRRMGRDVRVFKTGPDF
FT                   LDPMILARASGASVMSLDLWMVGEHACRALLAEAARNADLILIEGVMGLFDGTPSSADL
FT                   AAKFDVPVAAVISAKAMAQTFGAVAFGLARFRPDVPFHGVFANRVGSARHAQMLEESLP
FT                   AGLTMLGYLSSTDAIELPDRHLGLLQAAEIGDLDARLDRAAEALASTALAQLPPVVAFD
FT                   EPAQEATLPRLLDGMHIAIARDAAFAFIYPANVQLLEALGARVTYFSPLADEPVPVDAS
FT                   ALYLPGGYPELHALALAANARSAASVRAHAAANKTIVAECGGMLYLLDSVTDTQGITTP
FT                   MLGLLPGHAAMQTRFAALGMQQVDDSLHGTLTGHTFHYSRVSTPLAPVRHATRAQSDAP
FT                   GEAVYRQGSIVATYMHGYWPSNPAFAAALFNGRAF"
     atgcccgcgt gccccgctct cttcatcagc gcgccggcgt cgggccaggg caagacgacc        60
     gtcacggccg cgctcgcgcg gcatcatcga cgcatggggc gcgacgtgcg cgtgttcaag       120
     acgggcccgg attttctcga cccgatgatc ctcgcgcgcg cgagcggcgc gagcgtgatg       180
     tcgctggatc tgtggatggt cggcgagcac gcgtgtcgcg cgctgctcgc cgaagcggcg       240
     cgcaacgcgg acctgatcct gatcgaaggc gtgatgggcc tcttcgacgg cacgccgagc       300
     agcgccgacc tcgctgcgaa attcgacgtg cccgtcgcag ccgtgatctc ggcgaaagcg       360
     atggcgcaga ccttcggcgc ggtcgctttc ggcctcgcgc gctttcgtcc ggacgtgccg       420
     tttcatggcg tgtttgcgaa ccgggtcggc tccgcccgtc atgcgcagat gctcgaagaa       480
     tcattgcccg ccgggctgac gatgctcggc tatctgtcaa gcaccgatgc gatcgaattg       540
     cccgatcgac atctgggcct gctgcaggct gcggagatcg gcgatctcga cgcacggctc       600
     gatcgcgcgg cggaggcgct cgcgtcgacg gcgcttgcgc aactgccgcc tgtcgtggcg       660
     ttcgacgagc ccgcgcagga agcgacgttg ccgcgactgc tcgacggcat gcacatcgcc       720
     attgcgcgcg acgccgcgtt cgcgttcatc tatccggcga acgtgcagct gctcgaagca       780
     ctgggcgcgc gcgtcacgta tttctcgccg ctcgccgacg agcctgttcc cgtcgatgcg       840
     agcgcgctct atctgcccgg cggctatccg gagctgcatg cgcttgcgct cgccgccaat       900
     gcgcgcagcg cggcatccgt ccgcgcgcat gcggctgcca ataagaccat cgtcgccgaa       960
     tgcggcggca tgctgtatct actcgacagc gtcaccgaca cgcaaggcat cacgacgccg      1020
     atgctcggcc tgctgcccgg ccatgccgcg atgcagacgc gcttcgccgc gctcggcatg      1080
     cagcaggtcg acgacagctt gcatggcacg ctgacgggcc acacgttcca ctactcgcgc      1140
     gtgagcacgc cgctcgcgcc cgtgcgtcac gcgacgcgcg cacagtccga cgcgcccggc      1200
     gaagccgtct atcgtcaggg ttcgatcgtc gccacttaca tgcacggcta ctggccgtcc      1260
     aacccggcct tcgcggctgc cctcttcaat ggccgagcct tttga                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page