(data stored in ACNUC29543 zone)

EMBL: CP001044.PE562

CP001044.PE562       Location/Qualifiers
FT   CDS_pept        complement(645767..646657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3696"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: sde:Sde_3214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3696"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72831"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMN7"
FT                   /protein_id="ACC72831.1"
FT                   /translation="MQTLECVLPAAAALGECPRWDERRAKLWWVDIQAPALHAFDPKTG
FT                   QDTMLPMPENIGCFSLTEDDGFIAGMRTGIFLLDAKGQVVRKLCANPENPATSRFNDGR
FT                   CDAHGRFWLGTLDEPKAGNAAALYCYGNGALTKVDAGLLTSNGMAFSPDYRWCYHSDTP
FT                   RFTIYRHSYDVDSGEVGPREEWVKFEPTPTDRGRPDGASVDSEGFYWAALYEGGRVVRI
FT                   SPDGKVVETHPLAARCPTMCTFGGDDLRTLYVTTARQGRSAEELEQYPQSGAVFAMRVS
FT                   VPGLIEKRSALRVAD"
     atgcagacat tggagtgtgt gttgcccgcc gccgccgcgc tcggcgaatg cccgcgctgg        60
     gacgaacgcc gcgcgaagct gtggtgggtg gacatccagg cgcccgcgct gcacgccttc       120
     gatccgaaga cggggcagga cacgatgctg ccgatgcctg agaacatcgg ctgcttttcc       180
     ctgacggagg acgacggttt catcgccggc atgcgcacgg gcatttttct gctcgacgca       240
     aaagggcagg tcgtgcgcaa gctctgcgcg aacccggaga accccgcgac aagccgcttc       300
     aacgatggcc gttgcgacgc gcacgggcgc ttctggctag gcacgctcga cgagccgaag       360
     gcgggcaacg cggcagcgct ctactgctat ggaaacggcg cgttgacgaa ggtcgacgcc       420
     ggcttgctga cgtcgaacgg catggcgttc agccccgact accgctggtg ctatcactcg       480
     gacacgccgc gcttcaccat ctaccgccat tcgtacgatg tcgacagcgg cgaggtcgga       540
     ccgcgcgaag agtgggtgaa attcgagccg acgccgacgg atcgcgggcg tcccgatggc       600
     gcatcggtgg atagcgaggg gttttattgg gcggcgttgt acgaaggagg gcgcgtcgtg       660
     cggatctcgc ctgacggcaa agtggtcgaa acgcatccgc tcgccgcacg ctgtccgacc       720
     atgtgtacgt tcggcggcga cgatctgcgc acgctctacg tgacgacggc gcgccagggg       780
     cgttccgcgg aagagctcga acagtatccg cagtccggtg ccgtgtttgc aatgcgtgtg       840
     tcagtgccgg ggctgatcga aaaacgcagc gcgttgcgtg tcgcggattg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page