(data stored in ACNUC29543 zone)

EMBL: CP001044.PE564

CP001044.PE564       Location/Qualifiers
FT   CDS_pept        complement(647825..648433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3698"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   bur:Bcep18194_B1304 CBS domain containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3698"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72833"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMN9"
FT                   /protein_id="ACC72833.1"
FT                   /translation="MSISSVLHWCFGAQQHVGRDHGRSDGTDSPDDAERCSPQDERRAL
FT                   LGELQRQAYLHELLRLTCADVMRTPPVTVSVDETIGGALKTLDAHHIKLLPVVDTHGRL
FT                   KGVVTHVDLQPLDEVLPFLKLASDTTAPESERREWPVTTVMSAHVRYVDVLTPLTEIIP
FT                   LFTTNGHHHLPVVEEGGRVVGMLTQADILKLMCGRPGGI"
     atgtcaattt cgtcggtatt gcattggtgt ttcggagccc agcagcatgt cggacgggat        60
     cacggccgta gcgacggcac tgacagcccg gacgacgctg agcgctgctc gccgcaggac       120
     gaacggcggg cgctgctcgg cgaactgcaa cggcaggcct atctgcacga actgttgcgg       180
     ctcacctgcg cagatgtgat gcgtacgccg cccgttaccg tttccgtcga cgaaaccatc       240
     ggtggcgcat tgaaaacgct cgacgctcac catatcaagc tgctgcccgt ggtcgacacg       300
     catgggcggc tcaaaggcgt cgtcacgcat gtcgatctgc agccgctcga cgaagtgctg       360
     ccgtttctga aactcgcgtc cgacacgacc gcgcccgaaa gcgaacggcg cgagtggccc       420
     gtcacgaccg tgatgtcggc ccacgtccgg tacgtcgacg tgctgacgcc gctcacggaa       480
     atcattccgc tcttcacgac gaacggccat catcatttgc ccgtggtgga agagggcggg       540
     cgcgtggtcg gcatgctgac tcaagccgac atcctgaagc tgatgtgcgg ccgtcccggc       600
     ggcatttga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page